BLASTX nr result
ID: Achyranthes23_contig00027870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027870 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containi... 50 6e-08 ref|XP_004233739.1| PREDICTED: pentatricopeptide repeat-containi... 50 6e-08 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 49 7e-08 emb|CBI29825.3| unnamed protein product [Vitis vinifera] 49 7e-08 gb|EOY31969.1| Pentatricopeptide repeat (PPR) superfamily protei... 47 2e-07 ref|XP_004154607.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-06 ref|XP_006848380.1| hypothetical protein AMTR_s00013p00202120 [A... 47 1e-06 ref|XP_004140023.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-06 ref|XP_004295543.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 50 2e-06 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 44 6e-06 gb|EXB51207.1| hypothetical protein L484_019198 [Morus notabilis] 47 6e-06 >ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum tuberosum] Length = 775 Score = 50.1 bits (118), Expect(2) = 6e-08 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 +TYT++LSGLCQA R DA LLN M GC PD +T Sbjct: 226 ITYTVILSGLCQAKRTDDAYRLLNVMKTRGCRPDFVT 262 Score = 32.3 bits (72), Expect(2) = 6e-08 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CKSG+ DAL LFDEMT+ Sbjct: 201 CKSGRTHDALALFDEMTE 218 >ref|XP_004233739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum lycopersicum] Length = 753 Score = 50.1 bits (118), Expect(2) = 6e-08 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 +TYT++LSGLCQA R DA LLN M GC PD +T Sbjct: 204 ITYTVILSGLCQAKRTDDAYRLLNVMKTRGCKPDFVT 240 Score = 32.3 bits (72), Expect(2) = 6e-08 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CKSG+ DAL LFDEMT+ Sbjct: 179 CKSGRTHDALALFDEMTE 196 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 49.3 bits (116), Expect(2) = 7e-08 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 181 YTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 YTI+LSGLCQA R D LLN M SGC PD+IT Sbjct: 239 YTIILSGLCQAKRTDDVHRLLNTMKVSGCCPDSIT 273 Score = 32.7 bits (73), Expect(2) = 7e-08 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CK+GK +DAL +FDEMTQ Sbjct: 212 CKNGKTDDALKMFDEMTQ 229 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 49.3 bits (116), Expect(2) = 7e-08 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 181 YTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 YTI+LSGLCQA R D LLN M SGC PD+IT Sbjct: 239 YTIILSGLCQAKRTDDVHRLLNTMKVSGCCPDSIT 273 Score = 32.7 bits (73), Expect(2) = 7e-08 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CK+GK +DAL +FDEMTQ Sbjct: 212 CKNGKTDDALKMFDEMTQ 229 >gb|EOY31969.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 800 Score = 47.4 bits (111), Expect(2) = 2e-07 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = -3 Query: 184 TYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAI 80 +YTI++SGLCQA+R DA LLN+M SGC PD + Sbjct: 239 SYTIIVSGLCQADRADDACRLLNKMKESGCSPDFV 273 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CK+GK EDAL +FDEMTQ Sbjct: 213 CKNGKTEDALNMFDEMTQ 230 >ref|XP_004154607.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Cucumis sativus] Length = 950 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 + Y+IVLSGLCQA +I DAQ L ++M SGC D IT Sbjct: 234 IIYSIVLSGLCQAKKIFDAQRLFSKMRASGCNRDLIT 270 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMT 204 CK+ K +DALVLFDEMT Sbjct: 209 CKTCKTQDALVLFDEMT 225 >ref|XP_006848380.1| hypothetical protein AMTR_s00013p00202120 [Amborella trichopoda] gi|548851686|gb|ERN09961.1| hypothetical protein AMTR_s00013p00202120 [Amborella trichopoda] Length = 789 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 +TYTIV+SGLC A + DA+ LL M ++ CLPD IT Sbjct: 233 LTYTIVISGLCNARKTKDARKLLQTMRDNRCLPDDIT 269 Score = 31.2 bits (69), Expect(2) = 1e-06 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CK+GK +DAL+LFDEM + Sbjct: 208 CKAGKTQDALLLFDEMAK 225 >ref|XP_004140023.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Cucumis sativus] Length = 783 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 + Y+IVLSGLCQA +I DAQ L ++M SGC D IT Sbjct: 234 IIYSIVLSGLCQAKKIFDAQRLFSKMRASGCNRDLIT 270 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMT 204 CK+ K +DALVLFDEMT Sbjct: 209 CKTCKTQDALVLFDEMT 225 >ref|XP_004295543.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g79540-like [Fragaria vesca subsp. vesca] Length = 768 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAITSH 71 VTYTI++SGLCQA R +A L+++M +GC+P+ +T H Sbjct: 220 VTYTIIVSGLCQAKRAHEAHRLVDKMRETGCVPNIVTYH 258 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CK+ K +DAL +FDEM Q Sbjct: 195 CKTRKTQDALQMFDEMAQ 212 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 43.5 bits (101), Expect(2) = 6e-06 Identities = 18/37 (48%), Positives = 26/37 (70%) Frame = -3 Query: 187 VTYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAIT 77 +TYTI++SGLCQA + A L M + GC+PD++T Sbjct: 232 ITYTIIISGLCQAQKADVAYRLFIAMKDHGCIPDSVT 268 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CKSGK ++AL +FDEMTQ Sbjct: 207 CKSGKTQNALQMFDEMTQ 224 >gb|EXB51207.1| hypothetical protein L484_019198 [Morus notabilis] Length = 759 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = -3 Query: 184 TYTIVLSGLCQANRILDAQNLLNEMTNSGCLPDAI 80 TYTI++SGLCQA R+ +A+ LL M SGC PD + Sbjct: 198 TYTIIISGLCQAKRVDEARRLLITMEESGCCPDTV 232 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 254 CKSGKLEDALVLFDEMTQ 201 CKSG+++DA +FDEM + Sbjct: 172 CKSGQIQDAQKMFDEMAE 189