BLASTX nr result
ID: Achyranthes23_contig00027848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027848 (1017 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553006.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 63 2e-07 ref|XP_003530531.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 63 2e-07 gb|ACU23162.1| unknown [Glycine max] 63 2e-07 dbj|BAD25383.1| putative plastid ribosomal protein L19 precursor... 60 1e-06 ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] g... 60 1e-06 ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus... 60 1e-06 ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus... 60 1e-06 ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloro... 60 1e-06 gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilop... 60 1e-06 gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticu... 60 1e-06 ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloro... 60 1e-06 ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloro... 60 1e-06 dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgar... 60 1e-06 gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus... 60 2e-06 ref|XP_006837380.1| hypothetical protein AMTR_s00111p00125340 [A... 60 2e-06 ref|XP_003563681.1| PREDICTED: 50S ribosomal protein L19, chloro... 60 2e-06 gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] 59 2e-06 ref|XP_004975505.1| PREDICTED: 50S ribosomal protein L19, chloro... 59 2e-06 gb|AFW74290.1| hypothetical protein ZEAMMB73_091168 [Zea mays] 59 2e-06 gb|AFW61421.1| hypothetical protein ZEAMMB73_090575 [Zea mays] 59 2e-06 >ref|XP_003553006.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Glycine max] Length = 236 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLK 597 YSPNIKEI VLDKK+VRRAKLYYL+ERMNPLK Sbjct: 204 YSPNIKEIKVLDKKRVRRAKLYYLRERMNPLK 235 >ref|XP_003530531.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Glycine max] Length = 231 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLK 597 YSPNIKEI VLDKK+VRRAKLYYL+ERMNPLK Sbjct: 199 YSPNIKEIKVLDKKRVRRAKLYYLRERMNPLK 230 >gb|ACU23162.1| unknown [Glycine max] Length = 109 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLK 597 YSPNIKEI VLDKK+VRRAKLYYL+ERMNPLK Sbjct: 77 YSPNIKEIKVLDKKRVRRAKLYYLRERMNPLK 108 >dbj|BAD25383.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|125582333|gb|EAZ23264.1| hypothetical protein OsJ_06959 [Oryza sativa Japonica Group] Length = 211 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLD+KKVRRAKLYYL++RMN LKK Sbjct: 179 YSPNIKEIKVLDRKKVRRAKLYYLRDRMNALKK 211 >ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] gi|46390526|dbj|BAD16014.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|51536266|dbj|BAD38434.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|113535776|dbj|BAF08159.1| Os02g0205000 [Oryza sativa Japonica Group] gi|125538542|gb|EAY84937.1| hypothetical protein OsI_06303 [Oryza sativa Indica Group] gi|125581228|gb|EAZ22159.1| hypothetical protein OsJ_05821 [Oryza sativa Japonica Group] gi|215707036|dbj|BAG93496.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765566|dbj|BAG87263.1| unnamed protein product [Oryza sativa Japonica Group] Length = 222 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLD+KKVRRAKLYYL++RMN LKK Sbjct: 190 YSPNIKEIKVLDRKKVRRAKLYYLRDRMNALKK 222 >ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223550424|gb|EEF51911.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 190 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLDKKKVRRAKLYYL+++MN LKK Sbjct: 157 YSPNIKEIRVLDKKKVRRAKLYYLRDKMNALKK 189 >ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223540999|gb|EEF42557.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 248 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLDKKKVRRAKLYYL+++MN LKK Sbjct: 215 YSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 247 >ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Oryza brachyantha] Length = 222 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI +LD+KKVRRAKLYYL++RMN LKK Sbjct: 190 YSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 222 >gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilops tauschii] Length = 242 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI +LD+KKVRRAKLYYL++RMN LKK Sbjct: 210 YSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 242 >gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticum urartu] Length = 217 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI +LD+KKVRRAKLYYL++RMN LKK Sbjct: 185 YSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 217 >ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 242 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI +LDKKKVRRAKLYYL+++MN LKK Sbjct: 209 YSPNIKEIKILDKKKVRRAKLYYLRDKMNALKK 241 >ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 212 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI +LD+KKVRRAKLYYL++RMN LKK Sbjct: 180 YSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 212 >dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326520856|dbj|BAJ92791.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 217 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI +LD+KKVRRAKLYYL++RMN LKK Sbjct: 185 YSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 217 >gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus vulgaris] Length = 231 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLK 597 YSPNIKEI VLDKKKVRRAKLYYL++RMN LK Sbjct: 199 YSPNIKEIKVLDKKKVRRAKLYYLRDRMNALK 230 >ref|XP_006837380.1| hypothetical protein AMTR_s00111p00125340 [Amborella trichopoda] gi|548839998|gb|ERN00234.1| hypothetical protein AMTR_s00111p00125340 [Amborella trichopoda] Length = 194 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNI EI VLDKKKVRRAKLYYL++++NPLKK Sbjct: 162 YSPNIMEIKVLDKKKVRRAKLYYLRDKINPLKK 194 >ref|XP_003563681.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 217 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKE+ +LD+KKVRRAKLYYL++RMN LKK Sbjct: 185 YSPNIKEVKILDRKKVRRAKLYYLRDRMNALKK 217 >gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] Length = 187 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLDKKKVRRAKLYYL+++MN LK+ Sbjct: 154 YSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKR 186 >ref|XP_004975505.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Setaria italica] Length = 225 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLD+KKVRRAKLYYL++RMN L+K Sbjct: 193 YSPNIKEIKVLDRKKVRRAKLYYLRDRMNALRK 225 >gb|AFW74290.1| hypothetical protein ZEAMMB73_091168 [Zea mays] Length = 280 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLD+KKVRRAKLYYL++RMN LK+ Sbjct: 248 YSPNIKEIKVLDRKKVRRAKLYYLRDRMNALKR 280 >gb|AFW61421.1| hypothetical protein ZEAMMB73_090575 [Zea mays] Length = 81 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 502 YSPNIKEITVLDKKKVRRAKLYYLKERMNPLKK 600 YSPNIKEI VLD+KKVRRAKLYYL++RMN L+K Sbjct: 49 YSPNIKEIKVLDRKKVRRAKLYYLRDRMNALRK 81