BLASTX nr result
ID: Achyranthes23_contig00027600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027600 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 60 3e-07 ref|XP_002308958.1| calcium-dependent protein kinase [Populus tr... 60 3e-07 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 58 1e-06 ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase ... 58 2e-06 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 58 2e-06 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 57 2e-06 gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus pe... 57 3e-06 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 57 3e-06 ref|XP_002322709.1| calcium-dependent protein kinase [Populus tr... 57 3e-06 ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Ci... 56 4e-06 ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 56 6e-06 ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase ... 56 6e-06 gb|EOY32686.1| Calcium-dependent protein kinase 19 isoform 1 [Th... 55 7e-06 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 55 7e-06 gb|AFV29350.1| calcium-dependent protein kinase-like protein, pa... 55 1e-05 gb|AFV29312.1| calcium-dependent protein kinase-like protein, pa... 55 1e-05 gb|AFV29304.1| calcium-dependent protein kinase-like protein, pa... 55 1e-05 gb|AFV29292.1| calcium-dependent protein kinase-like protein, pa... 55 1e-05 gb|AFV29281.1| calcium-dependent protein kinase-like protein, pa... 55 1e-05 gb|AFV29280.1| calcium-dependent protein kinase-like protein, pa... 55 1e-05 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNSLSLKLM+DGSLQL NEGR Sbjct: 502 KASRQYSRERFNSLSLKLMRDGSLQLTNEGR 532 >ref|XP_002308958.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 528 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNSLSLKLM+DGSL+LANEGR Sbjct: 498 KASRQYSRERFNSLSLKLMRDGSLKLANEGR 528 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEG 263 KASRQYSRERFNSLSLKLM+DGSLQL NEG Sbjct: 502 KASRQYSRERFNSLSLKLMRDGSLQLTNEG 531 >ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase 8-like [Fragaria vesca subsp. vesca] Length = 532 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNS+SLKLM++GSLQL NEGR Sbjct: 502 KASRQYSRERFNSISLKLMREGSLQLTNEGR 532 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKL+KDGSLQ ANEGR Sbjct: 499 KASRQYSRERFNNLSLKLIKDGSLQSANEGR 529 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLM+DGSLQ+ NEGR Sbjct: 504 KASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534 >gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] Length = 425 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNS+SLKLM++GSLQLA EGR Sbjct: 395 KASRQYSRERFNSISLKLMREGSLQLATEGR 425 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRER+NSLSLKLMKDGSLQ++NE R Sbjct: 500 KASRQYSRERYNSLSLKLMKDGSLQMSNETR 530 >ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 532 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L +EGR Sbjct: 502 KASRQYSRERFNNLSLKLMKDGSLKLTSEGR 532 >ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Cicer arietinum] gi|59709749|gb|AAP72282.2| calcium-dependent calmodulin-independent protein kinase isoform 2 [Cicer arietinum] Length = 540 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNSLSLKLM+DGSLQL NE + Sbjct: 508 KASRQYSRERFNSLSLKLMRDGSLQLTNENQ 538 >ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 530 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNSLSLKLM+DGSL L NE R Sbjct: 500 KASRQYSRERFNSLSLKLMRDGSLHLTNEAR 530 >ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 531 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFNSLSLKLM+DGSL L NE R Sbjct: 501 KASRQYSRERFNSLSLKLMRDGSLHLTNEAR 531 >gb|EOY32686.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao] Length = 532 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLAN 269 KASRQYSRERFNSLSLKLM+DGSLQLAN Sbjct: 505 KASRQYSRERFNSLSLKLMRDGSLQLAN 532 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSLQ+ NE R Sbjct: 505 KASRQYSRERFNNLSLKLMKDGSLQMNNEPR 535 >gb|AFV29350.1| calcium-dependent protein kinase-like protein, partial [Senecio vulgaris] Length = 145 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L NE + Sbjct: 115 KASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29312.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188907|gb|AFV29313.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188913|gb|AFV29316.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188915|gb|AFV29317.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188917|gb|AFV29318.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188919|gb|AFV29319.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188921|gb|AFV29320.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188923|gb|AFV29321.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188925|gb|AFV29322.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188927|gb|AFV29323.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188933|gb|AFV29326.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188935|gb|AFV29327.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188953|gb|AFV29336.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188955|gb|AFV29337.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188961|gb|AFV29340.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L NE + Sbjct: 115 KASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29304.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188891|gb|AFV29305.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188929|gb|AFV29324.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] Length = 145 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L NE + Sbjct: 115 KASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29292.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188867|gb|AFV29293.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] Length = 145 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L NE + Sbjct: 115 KASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29281.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188845|gb|AFV29282.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188847|gb|AFV29283.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188887|gb|AFV29303.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188931|gb|AFV29325.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188957|gb|AFV29338.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188959|gb|AFV29339.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188963|gb|AFV29341.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L NE + Sbjct: 115 KASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29280.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] Length = 145 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 352 KASRQYSRERFNSLSLKLMKDGSLQLANEGR 260 KASRQYSRERFN+LSLKLMKDGSL+L NE + Sbjct: 115 KASRQYSRERFNNLSLKLMKDGSLELVNEDK 145