BLASTX nr result
ID: Achyranthes23_contig00027546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027546 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498547.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-li... 59 7e-07 ref|XP_006371816.1| hypothetical protein POPTR_0018s03910g [Popu... 58 1e-06 gb|AFN55276.1| NAC domain-containing protein [Tamarix hispida] 58 1e-06 ref|XP_006382188.1| hypothetical protein POPTR_0006s29180g [Popu... 56 6e-06 ref|XP_002330817.1| NAC domain protein, IPR003441 [Populus trich... 56 6e-06 ref|XP_004244460.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-li... 55 7e-06 ref|XP_002527980.1| transcription factor, putative [Ricinus comm... 55 7e-06 ref|XP_006407005.1| hypothetical protein EUTSA_v10021186mg [Eutr... 55 1e-05 ref|XP_004508725.1| PREDICTED: NAC domain-containing protein 100... 55 1e-05 ref|XP_006296616.1| hypothetical protein CARUB_v10014276mg [Caps... 55 1e-05 ref|XP_004299340.1| PREDICTED: NAC domain-containing protein 100... 55 1e-05 ref|XP_004299339.1| PREDICTED: NAC domain-containing protein 100... 55 1e-05 gb|AFQ21786.1| NAC2 protein [Rosa hybrid cultivar] 55 1e-05 dbj|BAB02571.1| unnamed protein product [Arabidopsis thaliana] 55 1e-05 ref|NP_188135.1| protein CUP-SHAPED COTYLEDON 1 [Arabidopsis tha... 55 1e-05 gb|ADU76438.1| CUP-SHAPED COTYLEDON 1 [Raphanus sativus] 55 1e-05 ref|XP_002882916.1| cup-shaped cotyledon1 [Arabidopsis lyrata su... 55 1e-05 >ref|XP_004498547.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-like [Cicer arietinum] Length = 346 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYLVNKI DS+FSC+AIG++DLNKSEP +LP Sbjct: 42 ITYYLVNKISDSDFSCKAIGEVDLNKSEPWELP 74 >ref|XP_006371816.1| hypothetical protein POPTR_0018s03910g [Populus trichocarpa] gi|550317989|gb|ERP49613.1| hypothetical protein POPTR_0018s03910g [Populus trichocarpa] Length = 334 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL NKI D++FSCRAIGD+DLNK EP DLP Sbjct: 28 ITYYLQNKISDADFSCRAIGDVDLNKCEPWDLP 60 >gb|AFN55276.1| NAC domain-containing protein [Tamarix hispida] Length = 342 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+NKI D+ FSCRAIGD+DLNK EP DLP Sbjct: 30 ITYYLLNKISDAAFSCRAIGDVDLNKCEPWDLP 62 >ref|XP_006382188.1| hypothetical protein POPTR_0006s29180g [Populus trichocarpa] gi|550337343|gb|ERP59985.1| hypothetical protein POPTR_0006s29180g [Populus trichocarpa] Length = 316 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL +KI D++FSCRAIGD+DLNK EP DLP Sbjct: 24 ITYYLQSKISDADFSCRAIGDVDLNKCEPWDLP 56 >ref|XP_002330817.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 316 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL +KI D++FSCRAIGD+DLNK EP DLP Sbjct: 24 ITYYLQSKISDADFSCRAIGDVDLNKCEPWDLP 56 >ref|XP_004244460.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2-like [Solanum lycopersicum] Length = 302 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYLVNKI D+NF+ RAI D+DLNKSEP DLP Sbjct: 24 ITYYLVNKINDANFTGRAIADVDLNKSEPWDLP 56 >ref|XP_002527980.1| transcription factor, putative [Ricinus communis] gi|223532606|gb|EEF34392.1| transcription factor, putative [Ricinus communis] Length = 379 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+NKI D+NF+ RAI D+DLNKSEP DLP Sbjct: 76 ITYYLINKISDANFTGRAIADVDLNKSEPWDLP 108 >ref|XP_006407005.1| hypothetical protein EUTSA_v10021186mg [Eutrema salsugineum] gi|557108151|gb|ESQ48458.1| hypothetical protein EUTSA_v10021186mg [Eutrema salsugineum] Length = 311 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+ K+LDSNFSC AI +DLNKSEP +LP Sbjct: 34 ITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP 66 >ref|XP_004508725.1| PREDICTED: NAC domain-containing protein 100-like [Cicer arietinum] Length = 430 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 I++YL K++DSNFS RAIGD+DLNKSEP DLP Sbjct: 109 ISHYLYKKVIDSNFSARAIGDVDLNKSEPWDLP 141 >ref|XP_006296616.1| hypothetical protein CARUB_v10014276mg [Capsella rubella] gi|482565325|gb|EOA29514.1| hypothetical protein CARUB_v10014276mg [Capsella rubella] Length = 300 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+ K+LDSNFSC AI +DLNKSEP +LP Sbjct: 34 ITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP 66 >ref|XP_004299340.1| PREDICTED: NAC domain-containing protein 100-like isoform 2 [Fragaria vesca subsp. vesca] Length = 356 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 I++YL K++DSNF C+AIGD+DLNKSEP DLP Sbjct: 37 ISHYLHKKVMDSNFGCKAIGDVDLNKSEPWDLP 69 >ref|XP_004299339.1| PREDICTED: NAC domain-containing protein 100-like isoform 1 [Fragaria vesca subsp. vesca] Length = 398 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 I++YL K++DSNF C+AIGD+DLNKSEP DLP Sbjct: 37 ISHYLHKKVMDSNFGCKAIGDVDLNKSEPWDLP 69 >gb|AFQ21786.1| NAC2 protein [Rosa hybrid cultivar] Length = 354 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 I++YL K++DSNF C+AIGD+DLNKSEP DLP Sbjct: 37 ISHYLHKKVIDSNFGCKAIGDVDLNKSEPWDLP 69 >dbj|BAB02571.1| unnamed protein product [Arabidopsis thaliana] Length = 337 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+ K+LDSNFSC AI +DLNKSEP +LP Sbjct: 34 ITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP 66 >ref|NP_188135.1| protein CUP-SHAPED COTYLEDON 1 [Arabidopsis thaliana] gi|75172269|sp|Q9FRV4.1|NAC54_ARATH RecName: Full=Protein CUP-SHAPED COTYLEDON 1; AltName: Full=NAC domain-containing protein 1; AltName: Full=NAC domain-containing protein 54; Short=ANAC054; AltName: Full=NAC domain-containing protein CUC1 gi|12060422|dbj|BAB20598.1| CUC1 [Arabidopsis thaliana] gi|109946515|gb|ABG48436.1| At3g15170 [Arabidopsis thaliana] gi|332642106|gb|AEE75627.1| protein CUP-SHAPED COTYLEDON 1 [Arabidopsis thaliana] Length = 310 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+ K+LDSNFSC AI +DLNKSEP +LP Sbjct: 34 ITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP 66 >gb|ADU76438.1| CUP-SHAPED COTYLEDON 1 [Raphanus sativus] Length = 192 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+ K+LDSNFSC AI +DLNKSEP +LP Sbjct: 17 ITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP 49 >ref|XP_002882916.1| cup-shaped cotyledon1 [Arabidopsis lyrata subsp. lyrata] gi|297328756|gb|EFH59175.1| cup-shaped cotyledon1 [Arabidopsis lyrata subsp. lyrata] Length = 310 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 285 ITYYLVNKILDSNFSCRAIGDIDLNKSEP*DLP 187 ITYYL+ K+LDSNFSC AI +DLNKSEP +LP Sbjct: 34 ITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP 66