BLASTX nr result
ID: Achyranthes23_contig00027337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027337 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242353.1| uncharacterized protein LOC100777335 precurs... 55 1e-05 >ref|NP_001242353.1| uncharacterized protein LOC100777335 precursor [Glycine max] gi|255635235|gb|ACU17972.1| unknown [Glycine max] Length = 367 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +1 Query: 79 LLAMELKKLLCSLYFAIFVVNIWVKVNGAPQVPCYFIFGDSLVDNG 216 + A++L + +L + + +W V GAPQVPCYFIFGDSLVDNG Sbjct: 1 MAALDLTISMLALIVVVVSLGLWGGVQGAPQVPCYFIFGDSLVDNG 46