BLASTX nr result
ID: Achyranthes23_contig00027174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027174 (626 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 60 4e-13 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 59.7 bits (143), Expect(2) = 4e-13 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = -2 Query: 172 EERRVGLAALYMFDKAETWATSYTATRHHVLWYDFVIDLVIRFKDDTISNVVEQLN 5 ++++V LA+L M DKAE W +SY R V W DFVID+ RFKD++ NVVE+ N Sbjct: 63 DKQKVDLASLNMVDKAENWVSSYLINRTAVDWNDFVIDVNSRFKDESGINVVEEFN 118 Score = 41.2 bits (95), Expect(2) = 4e-13 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 260 PKLKFPKFNGEHTRTWIKKICHY 192 PKLKFPKF+G + R WIKK C Y Sbjct: 33 PKLKFPKFDGSNLRQWIKKCCKY 55