BLASTX nr result
ID: Achyranthes23_contig00027004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00027004 (515 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310839.1| hypothetical protein POPTR_0007s13740g [Popu... 58 1e-06 >ref|XP_002310839.1| hypothetical protein POPTR_0007s13740g [Populus trichocarpa] gi|222853742|gb|EEE91289.1| hypothetical protein POPTR_0007s13740g [Populus trichocarpa] Length = 234 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = +1 Query: 1 NAGLVASGVARNMRRVGIYVKESIDDIFY---RRPK 99 N+GLVASGVARNMRRVGIY+K+S+DDI Y RRPK Sbjct: 199 NSGLVASGVARNMRRVGIYIKDSVDDILYPYRRRPK 234