BLASTX nr result
ID: Achyranthes23_contig00026725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00026725 (247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531516.1| dfg10 protein, putative [Ricinus communis] g... 60 2e-07 ref|XP_006487265.1| PREDICTED: polyprenol reductase 2-like isofo... 55 7e-06 ref|XP_006423507.1| hypothetical protein CICLE_v10028796mg [Citr... 55 7e-06 >ref|XP_002531516.1| dfg10 protein, putative [Ricinus communis] gi|223528869|gb|EEF30870.1| dfg10 protein, putative [Ricinus communis] Length = 342 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 91 MEIKIQILLRIAWIAGVLPILLASLPSSHLNPFNHALLVFAGRGE 225 MEI + LLR+AWIAG LPILLASLPSS LN F+ LL FA RG+ Sbjct: 1 MEIHLDWLLRLAWIAGTLPILLASLPSSSLNSFHQLLLGFAKRGK 45 >ref|XP_006487265.1| PREDICTED: polyprenol reductase 2-like isoform X1 [Citrus sinensis] gi|568867900|ref|XP_006487266.1| PREDICTED: polyprenol reductase 2-like isoform X2 [Citrus sinensis] Length = 338 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 91 MEIKIQILLRIAWIAGVLPILLASLPSSHLNPFNHALLVFAGRGE 225 ME + LLR AW+AG+LP+++ASLPSS LN F+ ALL FA RG+ Sbjct: 1 MESWLAGLLRAAWVAGILPLIIASLPSSRLNSFHGALLGFAKRGK 45 >ref|XP_006423507.1| hypothetical protein CICLE_v10028796mg [Citrus clementina] gi|567861708|ref|XP_006423508.1| hypothetical protein CICLE_v10028796mg [Citrus clementina] gi|557525441|gb|ESR36747.1| hypothetical protein CICLE_v10028796mg [Citrus clementina] gi|557525442|gb|ESR36748.1| hypothetical protein CICLE_v10028796mg [Citrus clementina] Length = 338 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 91 MEIKIQILLRIAWIAGVLPILLASLPSSHLNPFNHALLVFAGRGE 225 ME + LLR AW+AG+LP+++ASLPSS LN F+ ALL FA RG+ Sbjct: 1 MESWLAGLLRAAWVAGILPLIIASLPSSRLNSFHGALLGFAKRGK 45