BLASTX nr result
ID: Achyranthes23_contig00026635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00026635 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386526.1| hypothetical protein POPTR_0002s13530g [Popu... 67 2e-09 ref|XP_002302476.1| hypothetical protein POPTR_0002s13530g [Popu... 67 2e-09 ref|XP_002283278.1| PREDICTED: UPF0326 protein At4g17486 [Vitis ... 67 2e-09 ref|XP_006434946.1| hypothetical protein CICLE_v10002284mg [Citr... 67 3e-09 ref|XP_006434944.1| hypothetical protein CICLE_v10002284mg [Citr... 67 3e-09 ref|XP_006434943.1| hypothetical protein CICLE_v10002284mg [Citr... 67 3e-09 ref|XP_006473467.1| PREDICTED: deSI-like protein At4g17486-like ... 65 9e-09 gb|EXC07295.1| hypothetical protein L484_021202 [Morus notabilis] 62 8e-08 gb|EOX98564.1| PPPDE thiol peptidase family protein, putative is... 62 1e-07 ref|XP_002510351.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 emb|CBI32554.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002280976.1| PREDICTED: UPF0326 protein At4g17486-like [V... 60 2e-07 emb|CAN76535.1| hypothetical protein VITISV_034845 [Vitis vinifera] 60 2e-07 gb|EOX98566.1| PPPDE thiol peptidase family protein, putative is... 60 4e-07 gb|EOX98565.1| PPPDE thiol peptidase family protein, putative is... 60 4e-07 ref|XP_004238234.1| PREDICTED: deSI-like protein At4g17486-like ... 59 5e-07 ref|XP_004291894.1| PREDICTED: deSI-like protein At4g17486-like ... 59 7e-07 ref|XP_006423211.1| hypothetical protein CICLE_v10029154mg [Citr... 58 1e-06 ref|XP_006423210.1| hypothetical protein CICLE_v10029154mg [Citr... 58 1e-06 ref|XP_004148301.1| PREDICTED: deSI-like protein At4g17486-like ... 58 1e-06 >ref|XP_006386526.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|550344940|gb|ERP64323.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +K GWKSIMPLRL+ KSA RFCLFPK + ++ PG+TPVY Sbjct: 1 MKFGSKNGWKSIMPLRLKGKSATRFCLFPKPRSANYGPGDTPVY 44 >ref|XP_002302476.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|566157837|ref|XP_006386523.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|566157839|ref|XP_006386524.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|566157841|ref|XP_006386525.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|222844202|gb|EEE81749.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|550344937|gb|ERP64320.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|550344938|gb|ERP64321.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] gi|550344939|gb|ERP64322.1| hypothetical protein POPTR_0002s13530g [Populus trichocarpa] Length = 246 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +K GWKSIMPLRL+ KSA RFCLFPK + ++ PG+TPVY Sbjct: 1 MKFGSKNGWKSIMPLRLKGKSATRFCLFPKPRSANYGPGDTPVY 44 >ref|XP_002283278.1| PREDICTED: UPF0326 protein At4g17486 [Vitis vinifera] gi|302142454|emb|CBI19657.3| unnamed protein product [Vitis vinifera] Length = 247 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK KKGWKSI+PLRLR KSA RFC+FPK K + PGNTPVY Sbjct: 1 MKLGLKKGWKSIVPLRLRGKSATRFCIFPKVKSAGYGPGNTPVY 44 >ref|XP_006434946.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|557537068|gb|ESR48186.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] Length = 245 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +KGWKS++PLRL+ KSA RFCLFPK K +S PG PVY Sbjct: 1 MKFGLRKGWKSVVPLRLKGKSATRFCLFPKAKSTSYSPGRAPVY 44 >ref|XP_006434944.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|567884773|ref|XP_006434945.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|557537066|gb|ESR48184.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|557537067|gb|ESR48185.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] Length = 213 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +KGWKS++PLRL+ KSA RFCLFPK K +S PG PVY Sbjct: 1 MKFGLRKGWKSVVPLRLKGKSATRFCLFPKAKSTSYSPGRAPVY 44 >ref|XP_006434943.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|567884777|ref|XP_006434947.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|567884779|ref|XP_006434948.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|557537065|gb|ESR48183.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|557537069|gb|ESR48187.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] gi|557537070|gb|ESR48188.1| hypothetical protein CICLE_v10002284mg [Citrus clementina] Length = 247 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +KGWKS++PLRL+ KSA RFCLFPK K +S PG PVY Sbjct: 1 MKFGLRKGWKSVVPLRLKGKSATRFCLFPKAKSTSYSPGRAPVY 44 >ref|XP_006473467.1| PREDICTED: deSI-like protein At4g17486-like [Citrus sinensis] Length = 247 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +KK WKS++PLRL+ KSA RFCLFPK K +S PG PVY Sbjct: 1 MKFGSKKVWKSVVPLRLKGKSATRFCLFPKAKSTSYSPGRAPVY 44 >gb|EXC07295.1| hypothetical protein L484_021202 [Morus notabilis] Length = 259 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/44 (68%), Positives = 31/44 (70%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF KKGWK I PLRLR KSA RFCLF K K +S PG PVY Sbjct: 1 MKFGLKKGWKCIGPLRLRGKSATRFCLFSKAKSASYGPGRIPVY 44 >gb|EOX98564.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma cacao] Length = 306 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 +K TK GW SI+PLR R SA RFC+FPK K + S PGN PVY Sbjct: 16 LKMQTKHGWHSIVPLRFRGNSATRFCMFPKVKSAGSSPGNAPVY 59 >ref|XP_002510351.1| conserved hypothetical protein [Ricinus communis] gi|223551052|gb|EEF52538.1| conserved hypothetical protein [Ricinus communis] Length = 263 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF +KKGW+SIMPLRL+ KSA RF LFPK +S PG PVY Sbjct: 1 MKFGSKKGWRSIMPLRLKGKSATRFSLFPKPWSASYGPGTAPVY 44 >emb|CBI32554.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK +KK W SI+P RLR KSA RFC++PK K + PGNTPVY Sbjct: 1 MKSGSKKQWNSIVPFRLRGKSATRFCMYPKVKSAGRSPGNTPVY 44 >ref|XP_002280976.1| PREDICTED: UPF0326 protein At4g17486-like [Vitis vinifera] Length = 247 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK +KK W SI+P RLR KSA RFC++PK K + PGNTPVY Sbjct: 1 MKSGSKKQWNSIVPFRLRGKSATRFCMYPKVKSAGRSPGNTPVY 44 >emb|CAN76535.1| hypothetical protein VITISV_034845 [Vitis vinifera] Length = 558 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK +KK W SI+P RLR KSA RFC++PK K + PGNTPVY Sbjct: 56 MKSGSKKQWNSIVPFRLRGKSATRFCMYPKVKSAGRSPGNTPVY 99 >gb|EOX98566.1| PPPDE thiol peptidase family protein, putative isoform 3 [Theobroma cacao] Length = 240 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +1 Query: 307 TKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 TK GW SI+PLR R SA RFC+FPK K + S PGN PVY Sbjct: 3 TKHGWHSIVPLRFRGNSATRFCMFPKVKSAGSSPGNAPVY 42 >gb|EOX98565.1| PPPDE thiol peptidase family protein, putative isoform 2 [Theobroma cacao] Length = 244 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +1 Query: 307 TKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 TK GW SI+PLR R SA RFC+FPK K + S PGN PVY Sbjct: 3 TKHGWHSIVPLRFRGNSATRFCMFPKVKSAGSSPGNAPVY 42 >ref|XP_004238234.1| PREDICTED: deSI-like protein At4g17486-like [Solanum lycopersicum] Length = 247 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPV 423 M +KKGWKS+MPLRL+ KS+ FCL PK K DPG TPV Sbjct: 1 MSLQSKKGWKSVMPLRLKTKSSAHFCLLPKTKSDRFDPGETPV 43 >ref|XP_004291894.1| PREDICTED: deSI-like protein At4g17486-like [Fragaria vesca subsp. vesca] Length = 246 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MKF KK WKSI+PL+L++KSA RFCLFPK K S PG PVY Sbjct: 1 MKFGLKKRWKSIVPLQLKNKSANRFCLFPKSK-SGFGPGKAPVY 43 >ref|XP_006423211.1| hypothetical protein CICLE_v10029154mg [Citrus clementina] gi|568867726|ref|XP_006487184.1| PREDICTED: deSI-like protein At4g17486-like isoform X1 [Citrus sinensis] gi|568867728|ref|XP_006487185.1| PREDICTED: deSI-like protein At4g17486-like isoform X2 [Citrus sinensis] gi|568867730|ref|XP_006487186.1| PREDICTED: deSI-like protein At4g17486-like isoform X3 [Citrus sinensis] gi|557525145|gb|ESR36451.1| hypothetical protein CICLE_v10029154mg [Citrus clementina] Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK KKGW SI+PLRLR SA RFC+FPK K + GN PVY Sbjct: 1 MKLGPKKGWNSIVPLRLRGSSATRFCMFPKVKSAEFGRGNAPVY 44 >ref|XP_006423210.1| hypothetical protein CICLE_v10029154mg [Citrus clementina] gi|557525144|gb|ESR36450.1| hypothetical protein CICLE_v10029154mg [Citrus clementina] Length = 243 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK KKGW SI+PLRLR SA RFC+FPK K + GN PVY Sbjct: 1 MKLGPKKGWNSIVPLRLRGSSATRFCMFPKVKSAEFGRGNAPVY 44 >ref|XP_004148301.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus] gi|449492984|ref|XP_004159160.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus] Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +1 Query: 295 MKFVTKKGWKSIMPLRLRDKSALRFCLFPKGKLSSSDPGNTPVY 426 MK++++KGW SI+PL LR +S FC+F + K S PGNTPVY Sbjct: 1 MKYISEKGWNSIIPLHLRSESGSHFCIFSRAKGSRYGPGNTPVY 44