BLASTX nr result
ID: Achyranthes23_contig00026319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00026319 (214 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632114.1| PREDICTED: zinc finger CCCH domain-containin... 87 2e-15 emb|CAN74402.1| hypothetical protein VITISV_043632 [Vitis vinifera] 87 2e-15 ref|XP_006399772.1| hypothetical protein EUTSA_v10012818mg [Eutr... 86 7e-15 ref|XP_002277747.2| PREDICTED: zinc finger CCCH domain-containin... 84 2e-14 emb|CBI29869.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002871530.1| hypothetical protein ARALYDRAFT_488102 [Arab... 82 1e-13 ref|NP_196789.1| zinc finger CCCH domain-containing protein 56 [... 81 1e-13 gb|AAM20612.1| zinc finger transcription factor-like protein [Ar... 81 1e-13 ref|XP_006598269.1| PREDICTED: zinc finger CCCH domain-containin... 80 2e-13 ref|XP_004136593.1| PREDICTED: zinc finger CCCH domain-containin... 80 3e-13 ref|XP_004229627.1| PREDICTED: zinc finger CCCH domain-containin... 79 5e-13 gb|EXB53134.1| Zinc finger CCCH domain-containing protein 30 [Mo... 79 6e-13 ref|XP_006286367.1| hypothetical protein CARUB_v10000345mg [Caps... 79 6e-13 gb|EOX96688.1| CCCH-type zinc finger protein with ARM repeat dom... 78 1e-12 ref|XP_003540529.1| PREDICTED: zinc finger CCCH domain-containin... 78 1e-12 ref|XP_006587172.1| PREDICTED: zinc finger CCCH domain-containin... 76 4e-12 ref|XP_006351223.1| PREDICTED: zinc finger CCCH domain-containin... 76 4e-12 ref|XP_006345451.1| PREDICTED: zinc finger CCCH domain-containin... 76 4e-12 ref|XP_004249196.1| PREDICTED: zinc finger CCCH domain-containin... 76 4e-12 ref|XP_003533897.1| PREDICTED: zinc finger CCCH domain-containin... 76 4e-12 >ref|XP_003632114.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Vitis vinifera] Length = 725 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCF---------GNLSARSITIPPSNLNELFSAEI 61 RD+ EE ++LQD +++Q+ +LND+S F GNLS RS + PSNL+ELFSAE+ Sbjct: 454 RDMLVEEFNVLQDFDVQQQQLLNDLSHFTQPNLSSASGNLSVRSKALTPSNLDELFSAEM 513 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPRY+D +AAS++FSPSHK Sbjct: 514 SSPRYADHVAASTMFSPSHK 533 >emb|CAN74402.1| hypothetical protein VITISV_043632 [Vitis vinifera] Length = 718 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCF---------GNLSARSITIPPSNLNELFSAEI 61 RD+ EE ++LQD +++Q+ +LND+S F GNLS RS + PSNL+ELFSAE+ Sbjct: 447 RDMLVEEFNVLQDFDVQQQQLLNDLSHFTQPNLSSASGNLSVRSKALTPSNLDELFSAEM 506 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPRY+D +AAS++FSPSHK Sbjct: 507 SSPRYADHVAASTMFSPSHK 526 >ref|XP_006399772.1| hypothetical protein EUTSA_v10012818mg [Eutrema salsugineum] gi|312281485|dbj|BAJ33608.1| unnamed protein product [Thellungiella halophila] gi|557100862|gb|ESQ41225.1| hypothetical protein EUTSA_v10012818mg [Eutrema salsugineum] Length = 707 Score = 85.5 bits (210), Expect = 7e-15 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (2%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSC--FGNLSARSITIPPSNLNELFSAEISSPRYSD 40 RDIP+E+LS+LQ+ EM QR ++ DMS F N SAR T+ PSNL E+FS+E+SSPR+SD Sbjct: 449 RDIPSEQLSMLQEFEM-QRQLVGDMSSPRFMNHSARPKTLTPSNLEEIFSSEVSSPRFSD 507 Query: 39 PLAASSVFSPSHK 1 LA SSV SPSHK Sbjct: 508 QLAVSSVLSPSHK 520 >ref|XP_002277747.2| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Vitis vinifera] Length = 703 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIPAE+++++ D +++Q +LN++SC N S RS T+ PSNL+ELFSAE Sbjct: 428 RDIPAEDINLMLDFDIQQHQLLNELSCLSQPCVNSNSLNRSGRSKTLTPSNLDELFSAES 487 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPRYSD AS+V+SP+HK Sbjct: 488 SSPRYSDQALASAVYSPTHK 507 >emb|CBI29869.3| unnamed protein product [Vitis vinifera] Length = 619 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIPAE+++++ D +++Q +LN++SC N S RS T+ PSNL+ELFSAE Sbjct: 371 RDIPAEDINLMLDFDIQQHQLLNELSCLSQPCVNSNSLNRSGRSKTLTPSNLDELFSAES 430 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPRYSD AS+V+SP+HK Sbjct: 431 SSPRYSDQALASAVYSPTHK 450 >ref|XP_002871530.1| hypothetical protein ARALYDRAFT_488102 [Arabidopsis lyrata subsp. lyrata] gi|297317367|gb|EFH47789.1| hypothetical protein ARALYDRAFT_488102 [Arabidopsis lyrata subsp. lyrata] Length = 706 Score = 81.6 bits (200), Expect = 1e-13 Identities = 45/73 (61%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSC--FGNLSARSITIPPSNLNELFSAEISSPRYSD 40 RDIP+E+LS+L + EM QR + DM F N SAR T+ PSNL ELFSAE++SPR+SD Sbjct: 449 RDIPSEQLSMLHEFEM-QRQLAGDMHSPRFMNHSARPKTLTPSNLEELFSAEVASPRFSD 507 Query: 39 PLAASSVFSPSHK 1 LA SSV SPSHK Sbjct: 508 QLAVSSVLSPSHK 520 >ref|NP_196789.1| zinc finger CCCH domain-containing protein 56 [Arabidopsis thaliana] gi|75311680|sp|Q9LXV4.1|C3H56_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 56; Short=AtC3H56 gi|7630041|emb|CAB88249.1| zinc finger transcription factor-like protein [Arabidopsis thaliana] gi|110742550|dbj|BAE99190.1| zinc finger transcription factor -like protein [Arabidopsis thaliana] gi|332004438|gb|AED91821.1| zinc finger CCCH domain-containing protein 56 [Arabidopsis thaliana] Length = 706 Score = 81.3 bits (199), Expect = 1e-13 Identities = 45/73 (61%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSC--FGNLSARSITIPPSNLNELFSAEISSPRYSD 40 RDIP+E+LS+L + EM QR + DM F N SAR T+ PSNL ELFSAE++SPR+SD Sbjct: 449 RDIPSEQLSMLHEFEM-QRQLAGDMHSPRFMNHSARPKTLNPSNLEELFSAEVASPRFSD 507 Query: 39 PLAASSVFSPSHK 1 LA SSV SPSHK Sbjct: 508 QLAVSSVLSPSHK 520 >gb|AAM20612.1| zinc finger transcription factor-like protein [Arabidopsis thaliana] gi|22136426|gb|AAM91291.1| zinc finger transcription factor-like protein [Arabidopsis thaliana] Length = 706 Score = 81.3 bits (199), Expect = 1e-13 Identities = 45/73 (61%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSC--FGNLSARSITIPPSNLNELFSAEISSPRYSD 40 RDIP+E+LS+L + EM QR + DM F N SAR T+ PSNL ELFSAE++SPR+SD Sbjct: 449 RDIPSEQLSMLHEFEM-QRQLAGDMHSPRFMNHSARPKTLNPSNLEELFSAEVASPRFSD 507 Query: 39 PLAASSVFSPSHK 1 LA SSV SPSHK Sbjct: 508 QLAVSSVLSPSHK 520 >ref|XP_006598269.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Glycine max] Length = 722 Score = 80.5 bits (197), Expect = 2e-13 Identities = 46/81 (56%), Positives = 58/81 (71%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RD+P E+L +LQD + +Q H+LND+ CF + S RS T+ PSNL+ELFSAEI Sbjct: 451 RDMPPEDLDVLQDFDGQQ-HLLNDLGCFSQPHPGGISVSRSGRSKTLTPSNLDELFSAEI 509 Query: 60 -SSPRYSDPLAASSVFSPSHK 1 SSPRYSDP A +SVFSP+HK Sbjct: 510 SSSPRYSDP-AVASVFSPTHK 529 >ref|XP_004136593.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Cucumis sativus] gi|449516906|ref|XP_004165487.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 1 [Cucumis sativus] gi|449516908|ref|XP_004165488.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 2 [Cucumis sativus] Length = 701 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RD+P E+ L D +M+Q+ +LND++C N S R T+ PSNL++LFSAE Sbjct: 425 RDMPVEDFDYLSDFDMQQQQLLNDLNCLSQPPLSSNSLNRSGRMKTMTPSNLDDLFSAES 484 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPRYSD AS+VFSP+HK Sbjct: 485 SSPRYSDQSLASAVFSPTHK 504 >ref|XP_004229627.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Solanum lycopersicum] Length = 724 Score = 79.3 bits (194), Expect = 5e-13 Identities = 45/81 (55%), Positives = 55/81 (67%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIP E+ ++LQD + +Q +LNDM+C+ N S RS T+ PSNL ELFSAE+ Sbjct: 452 RDIPPEDFNMLQDFDAQQL-VLNDMACYSQPRPNSATLNRSGRSKTLTPSNLEELFSAEM 510 Query: 60 -SSPRYSDPLAASSVFSPSHK 1 SSPRYSD AA VFSPSHK Sbjct: 511 NSSPRYSDQAAACGVFSPSHK 531 >gb|EXB53134.1| Zinc finger CCCH domain-containing protein 30 [Morus notabilis] Length = 735 Score = 79.0 bits (193), Expect = 6e-13 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIPAE+ +L D +++Q+ +LN+ SC N S R T+ PSNL++LFSAE Sbjct: 458 RDIPAEDFDLLPDFDVQQQQLLNEFSCLSQPSMSSNSFNRSGRLKTLTPSNLDDLFSAES 517 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPRYSD S VFSP+HK Sbjct: 518 SSPRYSDQALPSGVFSPTHK 537 >ref|XP_006286367.1| hypothetical protein CARUB_v10000345mg [Capsella rubella] gi|565452838|ref|XP_006286368.1| hypothetical protein CARUB_v10000345mg [Capsella rubella] gi|482555073|gb|EOA19265.1| hypothetical protein CARUB_v10000345mg [Capsella rubella] gi|482555074|gb|EOA19266.1| hypothetical protein CARUB_v10000345mg [Capsella rubella] Length = 705 Score = 79.0 bits (193), Expect = 6e-13 Identities = 44/73 (60%), Positives = 53/73 (72%), Gaps = 2/73 (2%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSC--FGNLSARSITIPPSNLNELFSAEISSPRYSD 40 RDIP+E+LS+L + EM QR + DM F N SAR T+ PSNL ELFSAE++SPR+SD Sbjct: 448 RDIPSEQLSMLHEFEM-QRQLSGDMHSPRFMNHSARPKTLTPSNLEELFSAEVASPRFSD 506 Query: 39 PLAASSVFSPSHK 1 L SSV SPSHK Sbjct: 507 QLNVSSVLSPSHK 519 >gb|EOX96688.1| CCCH-type zinc finger protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508704793|gb|EOX96689.1| CCCH-type zinc finger protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508704794|gb|EOX96690.1| CCCH-type zinc finger protein with ARM repeat domain isoform 1 [Theobroma cacao] Length = 734 Score = 77.8 bits (190), Expect = 1e-12 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFGNL---------SARSITIPPSNLNELFSAEI 61 RDIP E+ +L+D + +Q+ ILND++CF S RS T+ PSNL ELFSAEI Sbjct: 457 RDIPPEDFDMLRDFDAQQQ-ILNDLTCFSQSRNNSVSVSHSGRSKTLTPSNLEELFSAEI 515 Query: 60 SS-PRYSDPLAASSVFSPSHK 1 SS PRY+D AAS+VFSP+HK Sbjct: 516 SSSPRYTDQTAASAVFSPTHK 536 >ref|XP_003540529.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X1 [Glycine max] Length = 704 Score = 77.8 bits (190), Expect = 1e-12 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCF-------GNLS--ARSITIPPSNLNELFSAEI 61 RD+P ++L+++ DL+ +Q+H LND+SC+ G++S RS + PSNL +LFSAEI Sbjct: 427 RDMPPDDLNMMSDLDGQQQHPLNDLSCYLQPRPGAGSVSRSGRSKILTPSNLEDLFSAEI 486 Query: 60 SS-PRYSDPLAASSVFSPSHK 1 SS PRYSDP AA SVFSP+HK Sbjct: 487 SSSPRYSDP-AAGSVFSPTHK 506 >ref|XP_006587172.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X2 [Glycine max] Length = 728 Score = 76.3 bits (186), Expect = 4e-12 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RD+P E+ +LQD + +Q H+L+D+ CF + S RS T+ PSNL+ELFSAEI Sbjct: 451 RDMPPEDFDVLQDFDGQQ-HLLSDLGCFSQPRPGAISVSRSGRSKTLTPSNLDELFSAEI 509 Query: 60 -SSPRYSDPLAASSVFSPSHK 1 SSPRYSDP A +SVFSP HK Sbjct: 510 SSSPRYSDP-AVASVFSPRHK 529 >ref|XP_006351223.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Solanum tuberosum] Length = 703 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/80 (47%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIPA++L++L D +++Q+ +LN +SC N S R T+ PSNL +LFSAE Sbjct: 427 RDIPAKDLTMLSDFDVQQQQLLNGLSCLSQSSMSANSFNRSVRPKTLTPSNLEDLFSAEG 486 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPR+SD + +VFSP+HK Sbjct: 487 SSPRFSDQALSQAVFSPTHK 506 >ref|XP_006345451.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X1 [Solanum tuberosum] gi|565357238|ref|XP_006345452.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X2 [Solanum tuberosum] Length = 730 Score = 76.3 bits (186), Expect = 4e-12 Identities = 43/81 (53%), Positives = 54/81 (66%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIP E+ ++LQD + +Q + NDM+C+ N S RS T+ PSNL ELFSAE+ Sbjct: 451 RDIPPEDFNMLQDFDAQQL-VFNDMACYSQQRPNSASLNRSGRSKTLTPSNLEELFSAEM 509 Query: 60 -SSPRYSDPLAASSVFSPSHK 1 SSPR+SD AA VFSPSHK Sbjct: 510 NSSPRFSDQAAACGVFSPSHK 530 >ref|XP_004249196.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 1 [Solanum lycopersicum] gi|460407514|ref|XP_004249197.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 2 [Solanum lycopersicum] gi|460407516|ref|XP_004249198.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 3 [Solanum lycopersicum] Length = 703 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/80 (47%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RDIPA++L++L D +++Q+ +LN +SC N S R T+ PSNL +LFSAE Sbjct: 427 RDIPAKDLTMLSDFDVQQQQLLNGLSCLSQSSTHANSFNRSVRPKTLTPSNLEDLFSAEG 486 Query: 60 SSPRYSDPLAASSVFSPSHK 1 SSPR+SD + +VFSP+HK Sbjct: 487 SSPRFSDQALSQAVFSPTHK 506 >ref|XP_003533897.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X1 [Glycine max] Length = 701 Score = 76.3 bits (186), Expect = 4e-12 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 10/81 (12%) Frame = -2 Query: 213 RDIPAEELSILQDLEMEQRHILNDMSCFG---------NLSARSITIPPSNLNELFSAEI 61 RD+P E+ +LQD + +Q H+L+D+ CF + S RS T+ PSNL+ELFSAEI Sbjct: 424 RDMPPEDFDVLQDFDGQQ-HLLSDLGCFSQPRPGAISVSRSGRSKTLTPSNLDELFSAEI 482 Query: 60 -SSPRYSDPLAASSVFSPSHK 1 SSPRYSDP A +SVFSP HK Sbjct: 483 SSSPRYSDP-AVASVFSPRHK 502