BLASTX nr result
ID: Achyranthes23_contig00025834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00025834 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHI42989.1| heavy metal-associated protein [Atriplex canescens] 62 1e-07 >gb|AHI42989.1| heavy metal-associated protein [Atriplex canescens] Length = 316 Score = 61.6 bits (148), Expect = 1e-07 Identities = 39/62 (62%), Positives = 44/62 (70%), Gaps = 9/62 (14%) Frame = +1 Query: 52 TVID-DAKIMM-----INRSFDYYSPSARYDYM-EYHH-HNNLNYQP-LIFSDENPNACS 204 T+ID D K MM IN S DYY P+ RYDYM +Y++ H N NYQP IFSDENPNACS Sbjct: 255 TIIDQDVKKMMMMGGNINGSNDYYWPAPRYDYMVDYNNVHYNHNYQPPQIFSDENPNACS 314 Query: 205 IM 210 IM Sbjct: 315 IM 316