BLASTX nr result
ID: Achyranthes23_contig00025760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00025760 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006603645.1| PREDICTED: uncharacterized protein LOC100306... 77 2e-12 ref|NP_001239720.1| uncharacterized protein LOC100785425 [Glycin... 77 2e-12 ref|NP_001235460.1| uncharacterized protein LOC100306722 [Glycin... 77 2e-12 gb|ESW34109.1| hypothetical protein PHAVU_001G125100g [Phaseolus... 76 5e-12 ref|XP_004142650.1| PREDICTED: mitochondria fission 1 protein-li... 75 9e-12 ref|XP_004493417.1| PREDICTED: mitochondria fission 1 protein-li... 75 1e-11 gb|AFK41177.1| unknown [Lotus japonicus] gi|388509168|gb|AFK4265... 73 3e-11 ref|XP_003632733.1| PREDICTED: mitochondria fission 1 protein-li... 73 5e-11 gb|EOY09045.1| Tetratricopeptide repeat (TPR)-like superfamily p... 72 6e-11 ref|XP_004252888.1| PREDICTED: mitochondria fission 1 protein-li... 72 8e-11 ref|XP_002529168.1| conserved hypothetical protein [Ricinus comm... 72 8e-11 ref|XP_002323259.1| hypothetical protein POPTR_0016s03840g [Popu... 72 8e-11 ref|XP_006362311.1| PREDICTED: mitochondrial fission 1 protein A... 72 1e-10 ref|XP_006380989.1| hypothetical protein POPTR_0006s04020g [Popu... 72 1e-10 gb|EPS70265.1| hypothetical protein M569_04493, partial [Genlise... 72 1e-10 ref|XP_004250907.1| PREDICTED: mitochondria fission 1 protein-li... 72 1e-10 ref|XP_002279516.2| PREDICTED: mitochondria fission 1 protein [V... 71 1e-10 emb|CBI24220.3| unnamed protein product [Vitis vinifera] 71 1e-10 gb|AFK47054.1| unknown [Medicago truncatula] 71 2e-10 ref|XP_003625031.1| Mitochondrial fission 1 protein [Medicago tr... 71 2e-10 >ref|XP_006603645.1| PREDICTED: uncharacterized protein LOC100306722 isoform X1 [Glycine max] Length = 167 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS+DYGRSRQLV QCLEIAPDWRQAL+LKK VED+I Sbjct: 97 AVGYYRSNDYGRSRQLVEQCLEIAPDWRQALSLKKIVEDRI 137 >ref|NP_001239720.1| uncharacterized protein LOC100785425 [Glycine max] gi|255631918|gb|ACU16326.1| unknown [Glycine max] Length = 167 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS+DYGRSRQLV QCLEIAPDWRQAL+LKK VED+I Sbjct: 97 AVGYYRSNDYGRSRQLVEQCLEIAPDWRQALSLKKIVEDRI 137 >ref|NP_001235460.1| uncharacterized protein LOC100306722 [Glycine max] gi|255629375|gb|ACU15032.1| unknown [Glycine max] Length = 181 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS+DYGRSRQLV QCLEIAPDWRQAL+LKK VED+I Sbjct: 97 AVGYYRSNDYGRSRQLVEQCLEIAPDWRQALSLKKIVEDRI 137 >gb|ESW34109.1| hypothetical protein PHAVU_001G125100g [Phaseolus vulgaris] Length = 172 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS+DYGRSRQLV QCL+IAPDWRQALTLKK VE++I Sbjct: 102 AVGYYRSNDYGRSRQLVDQCLQIAPDWRQALTLKKIVEERI 142 >ref|XP_004142650.1| PREDICTED: mitochondria fission 1 protein-like [Cucumis sativus] gi|449506674|ref|XP_004162815.1| PREDICTED: mitochondria fission 1 protein-like [Cucumis sativus] Length = 167 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS +Y RSRQLV QCLEIAPDWRQALTLKK VED+I Sbjct: 97 AVGYYRSGEYARSRQLVEQCLEIAPDWRQALTLKKTVEDQI 137 >ref|XP_004493417.1| PREDICTED: mitochondria fission 1 protein-like [Cicer arietinum] Length = 167 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYR++DYGRSRQL+ QCLEIAPDWRQAL+LKK VE++I Sbjct: 97 AVGYYRTNDYGRSRQLLEQCLEIAPDWRQALSLKKTVEERI 137 >gb|AFK41177.1| unknown [Lotus japonicus] gi|388509168|gb|AFK42650.1| unknown [Lotus japonicus] Length = 167 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS+DYGRSR+L+ QCLEIAPDWRQA +LKK VED+I Sbjct: 97 AVGYYRSNDYGRSRELLEQCLEIAPDWRQARSLKKAVEDRI 137 >ref|XP_003632733.1| PREDICTED: mitochondria fission 1 protein-like [Vitis vinifera] gi|297739910|emb|CBI30092.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS +YG+SRQLV QCLEIAPD+RQALTLKK VED+I Sbjct: 97 AVGYYRSGEYGKSRQLVEQCLEIAPDFRQALTLKKTVEDRI 137 >gb|EOY09045.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 167 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYR+ +Y RSRQLV QCLEIAPDWRQAL LKK VED+I Sbjct: 97 AVGYYRTGEYSRSRQLVEQCLEIAPDWRQALALKKTVEDRI 137 >ref|XP_004252888.1| PREDICTED: mitochondria fission 1 protein-like [Solanum lycopersicum] gi|565366235|ref|XP_006349799.1| PREDICTED: mitochondrial fission 1 protein A-like [Solanum tuberosum] Length = 167 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS D+ RSRQLV +CLEIAPDWRQALTLKK +E+KI Sbjct: 97 AVGYYRSGDFPRSRQLVDRCLEIAPDWRQALTLKKTIEEKI 137 >ref|XP_002529168.1| conserved hypothetical protein [Ricinus communis] gi|223531392|gb|EEF33227.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS DY RSRQLV QCL +APDWRQAL LKK +ED+I Sbjct: 33 AVGYYRSGDYSRSRQLVEQCLAVAPDWRQALVLKKTIEDRI 73 >ref|XP_002323259.1| hypothetical protein POPTR_0016s03840g [Populus trichocarpa] gi|222867889|gb|EEF05020.1| hypothetical protein POPTR_0016s03840g [Populus trichocarpa] Length = 167 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS +Y RSRQLV QCLEIAPDWRQAL LKK +ED+I Sbjct: 97 AVGYYRSGEYSRSRQLVDQCLEIAPDWRQALVLKKTLEDRI 137 >ref|XP_006362311.1| PREDICTED: mitochondrial fission 1 protein A-like [Solanum tuberosum] Length = 170 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS DY RSRQLV +CLEI P+WRQALTL+K +EDKI Sbjct: 97 AVGYYRSGDYARSRQLVERCLEIEPEWRQALTLRKTIEDKI 137 >ref|XP_006380989.1| hypothetical protein POPTR_0006s04020g [Populus trichocarpa] gi|550335419|gb|ERP58786.1| hypothetical protein POPTR_0006s04020g [Populus trichocarpa] Length = 114 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS +Y RSRQLV QCLEIAPDWRQAL LKK +ED++ Sbjct: 44 AVGYYRSGEYSRSRQLVDQCLEIAPDWRQALVLKKTLEDRV 84 >gb|EPS70265.1| hypothetical protein M569_04493, partial [Genlisea aurea] Length = 165 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVG+YRS DY RSRQLV +CLEIAPDWRQAL LKK +EDKI Sbjct: 94 AVGHYRSGDYSRSRQLVERCLEIAPDWRQALALKKAIEDKI 134 >ref|XP_004250907.1| PREDICTED: mitochondria fission 1 protein-like [Solanum lycopersicum] Length = 170 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS DY RSRQLV +CLEI P+WRQALTL+K VEDKI Sbjct: 97 AVGYYRSGDYARSRQLVDRCLEIEPEWRQALTLRKTVEDKI 137 >ref|XP_002279516.2| PREDICTED: mitochondria fission 1 protein [Vitis vinifera] Length = 175 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS DY RSRQLV CLEIAPDWRQA TLKK +ED+I Sbjct: 97 AVGYYRSGDYSRSRQLVECCLEIAPDWRQAQTLKKTIEDRI 137 >emb|CBI24220.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYRS DY RSRQLV CLEIAPDWRQA TLKK +ED+I Sbjct: 97 AVGYYRSGDYSRSRQLVECCLEIAPDWRQAQTLKKTIEDRI 137 >gb|AFK47054.1| unknown [Medicago truncatula] Length = 167 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYR+ DY RSRQL+ QCLEIAPDWRQAL+LKK VE++I Sbjct: 97 AVGYYRATDYPRSRQLLEQCLEIAPDWRQALSLKKTVEERI 137 >ref|XP_003625031.1| Mitochondrial fission 1 protein [Medicago truncatula] gi|124359978|gb|ABN07994.1| Protein kinase [Medicago truncatula] gi|355500046|gb|AES81249.1| Mitochondrial fission 1 protein [Medicago truncatula] Length = 167 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 1 AVGYYRSDDYGRSRQLVAQCLEIAPDWRQALTLKKNVEDKI 123 AVGYYR+ DY RSRQL+ QCLEIAPDWRQAL+LKK VE++I Sbjct: 97 AVGYYRATDYPRSRQLLEQCLEIAPDWRQALSLKKTVEERI 137