BLASTX nr result
ID: Achyranthes23_contig00025666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00025666 (525 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78907.1| hypothetical protein (mitochondrion) [Vicia faba]... 93 2e-19 gb|AGC78906.1| hypothetical protein (mitochondrion) [Vicia faba]... 69 6e-10 emb|CBI31105.3| unnamed protein product [Vitis vinifera] 68 1e-09 >gb|AGC78907.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803201|gb|AGC78936.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803286|gb|AGC79021.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 116 Score = 93.2 bits (230), Expect(2) = 2e-19 Identities = 55/74 (74%), Positives = 58/74 (78%) Frame = -1 Query: 276 AKGMNVVLVEAFFLLPY**GGAQDVRGVHAFRTTTRMVVLGWIPLLNIRGRGPGLSYQKG 97 A+ NVVLVEA F P GA+DVRGV AFRTTT +VVLG IPLLNIR RG GLSYQKG Sbjct: 12 ARKRNVVLVEALF--PLLVLGARDVRGVRAFRTTTGLVVLGRIPLLNIRDRG-GLSYQKG 68 Query: 96 CKKRTRPLISFDVP 55 CKKRTR ISFDVP Sbjct: 69 CKKRTRLPISFDVP 82 Score = 28.5 bits (62), Expect(2) = 2e-19 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 313 MTNRVRH*TTSARKRN 266 MTNRVRH SARKRN Sbjct: 1 MTNRVRHLAKSARKRN 16 >gb|AGC78906.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803202|gb|AGC78937.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803285|gb|AGC79020.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 111 Score = 68.9 bits (167), Expect = 6e-10 Identities = 54/122 (44%), Positives = 61/122 (50%), Gaps = 4/122 (3%) Frame = +2 Query: 134 MFRSGIHPRTTILVVVRKAWTPRTSCAPPY**GRRKKASTRTTFIPFACGCSLVSDSIGH 313 MFRSGI PRTT VVVRKA TPRTS AP + KASTRTTF+ L +D Sbjct: 1 MFRSGIRPRTTSPVVVRKARTPRTSRAPKT--NKGNKASTRTTFL-------LRADLAKC 51 Query: 314 SFLLLRPVLVCARV----NQPNKEGKDALSGHLRMIRAV*RETFKYSLFFFGGGRSPTGS 481 LL+ C + N NKE + R + FFGGGRSPTGS Sbjct: 52 LTLLVIVPCCCGQCSFARNPTNKERMPLGASENDSSRM--KGNSHVQFVFFGGGRSPTGS 109 Query: 482 PH 487 PH Sbjct: 110 PH 111 >emb|CBI31105.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/67 (53%), Positives = 38/67 (56%) Frame = +3 Query: 6 LAFLL*KSWSNRVVLAPERRMK*VAGFSFYNPFDMIGPAPFPLCLGAGSTQERPFLWWYG 185 LAFLL KS SNR P+P+PLCLGAGS QERP LWWYG Sbjct: 172 LAFLLSKSRSNRAC-----------------------PSPYPLCLGAGSAQERPVLWWYG 208 Query: 186 RHGLRER 206 RHGLRER Sbjct: 209 RHGLRER 215