BLASTX nr result
ID: Achyranthes23_contig00025652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00025652 (719 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267957.1| PREDICTED: salt tolerance protein [Vitis vin... 57 6e-06 >ref|XP_002267957.1| PREDICTED: salt tolerance protein [Vitis vinifera] gi|297744726|emb|CBI37988.3| unnamed protein product [Vitis vinifera] Length = 210 Score = 57.0 bits (136), Expect = 6e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 1 IDLNARPQRTVQQSSNNQVMDDVVGANGDSASVVPFKSFKSEPEK 135 IDLNARPQR Q+SNNQ MD G N +S SVVP SFK EPEK Sbjct: 166 IDLNARPQRVHGQTSNNQSMDVHSGTNHESESVVPVGSFKREPEK 210