BLASTX nr result
ID: Achyranthes23_contig00025033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00025033 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429645.1| hypothetical protein CICLE_v10012376mg [Citr... 56 6e-06 ref|XP_006429644.1| hypothetical protein CICLE_v10012376mg [Citr... 56 6e-06 >ref|XP_006429645.1| hypothetical protein CICLE_v10012376mg [Citrus clementina] gi|568855308|ref|XP_006481249.1| PREDICTED: KH domain-containing protein At3g08620-like isoform X1 [Citrus sinensis] gi|557531702|gb|ESR42885.1| hypothetical protein CICLE_v10012376mg [Citrus clementina] Length = 287 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 119 MSGLYNPNFSPARAASPQIRSTAAASDDSQYL 214 MSGLYNPNFSPARAASPQIRST + DSQYL Sbjct: 1 MSGLYNPNFSPARAASPQIRSTPDINIDSQYL 32 >ref|XP_006429644.1| hypothetical protein CICLE_v10012376mg [Citrus clementina] gi|568855310|ref|XP_006481250.1| PREDICTED: KH domain-containing protein At3g08620-like isoform X2 [Citrus sinensis] gi|557531701|gb|ESR42884.1| hypothetical protein CICLE_v10012376mg [Citrus clementina] Length = 283 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 119 MSGLYNPNFSPARAASPQIRSTAAASDDSQYL 214 MSGLYNPNFSPARAASPQIRST + DSQYL Sbjct: 1 MSGLYNPNFSPARAASPQIRSTPDINIDSQYL 32