BLASTX nr result
ID: Achyranthes23_contig00024778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00024778 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273246.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 71 1e-10 emb|CAN62825.1| hypothetical protein VITISV_003206 [Vitis vinifera] 71 1e-10 gb|EPS62520.1| hypothetical protein M569_12270, partial [Genlise... 71 2e-10 ref|XP_006363139.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 69 9e-10 ref|NP_001233921.1| Xaa-Pro aminopeptidase 1 [Solanum lycopersic... 68 1e-09 ref|XP_002310793.2| aminopeptidase P family protein, partial [Po... 68 1e-09 ref|XP_006370826.1| hypothetical protein POPTR_0019s00400g [Popu... 68 1e-09 ref|XP_006389281.1| hypothetical protein POPTR_0031s00410g, part... 68 1e-09 gb|EOX91163.1| Aminopeptidase P1 isoform 1 [Theobroma cacao] 68 1e-09 ref|XP_004232381.1| PREDICTED: xaa-Pro aminopeptidase 1-like [So... 68 1e-09 ref|XP_002310789.1| predicted protein [Populus trichocarpa] 68 1e-09 ref|XP_006381257.1| hypothetical protein POPTR_0006s11120g [Popu... 68 1e-09 ref|XP_006285193.1| hypothetical protein CARUB_v10006543mg [Caps... 67 2e-09 gb|AAN41402.1| aminopeptidase P [Arabidopsis thaliana] 67 2e-09 ref|XP_003537557.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 67 2e-09 ref|XP_002869024.1| ATAPP1 [Arabidopsis lyrata subsp. lyrata] gi... 67 2e-09 ref|NP_195394.4| aminopeptidase P1 [Arabidopsis thaliana] gi|332... 67 2e-09 gb|AAS58497.1| aminopeptidase P short isoform [Arabidopsis thali... 67 2e-09 emb|CAB16823.1| aminopeptidase-like protein [Arabidopsis thalian... 67 2e-09 ref|XP_006662971.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 67 3e-09 >ref|XP_002273246.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Vitis vinifera] gi|297735202|emb|CBI17564.3| unnamed protein product [Vitis vinifera] Length = 642 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LLTPEEI WVN+YHS CR+IL+PY++++EMAWL+ +TEP+ V Sbjct: 601 LLTPEEIEWVNSYHSTCRDILAPYLDESEMAWLKRSTEPLSV 642 >emb|CAN62825.1| hypothetical protein VITISV_003206 [Vitis vinifera] Length = 240 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LLTPEEI WVN+YHS CR+IL+PY++++EMAWL+ +TEP+ V Sbjct: 199 LLTPEEIEWVNSYHSTCRDILAPYLDESEMAWLKRSTEPLSV 240 >gb|EPS62520.1| hypothetical protein M569_12270, partial [Genlisea aurea] Length = 172 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPI 264 LL PEEI W+NNYH+ CREILSP++ND+E+ WLR ATEP+ Sbjct: 131 LLGPEEIDWLNNYHAECREILSPFLNDSELEWLRRATEPV 170 >ref|XP_006363139.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like isoform X1 [Solanum tuberosum] Length = 655 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPI 264 LL PEEI W+N YH++CREIL+PY+N +EM WL+ ATEPI Sbjct: 614 LLVPEEIEWLNEYHAKCREILTPYLNKSEMEWLKKATEPI 653 >ref|NP_001233921.1| Xaa-Pro aminopeptidase 1 [Solanum lycopersicum] gi|15384989|emb|CAC59823.1| Xaa-Pro aminopeptidase 1 [Solanum lycopersicum] Length = 655 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPI 264 LL PEEI W+N YH++CREIL+PY+N +EM WL+ ATEPI Sbjct: 614 LLIPEEIEWLNEYHAKCREILTPYLNTSEMEWLKKATEPI 653 >ref|XP_002310793.2| aminopeptidase P family protein, partial [Populus trichocarpa] gi|550334725|gb|EEE91243.2| aminopeptidase P family protein, partial [Populus trichocarpa] Length = 677 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LL PEEI+W+N YH RCR+IL+PY++++EMAWL ATEPI V Sbjct: 636 LLGPEEINWLNIYHGRCRDILAPYLDESEMAWLNKATEPIGV 677 >ref|XP_006370826.1| hypothetical protein POPTR_0019s00400g [Populus trichocarpa] gi|550316367|gb|ERP48623.1| hypothetical protein POPTR_0019s00400g [Populus trichocarpa] Length = 100 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LL PEEI+W N+YH RCR+IL+PY++++EMAWL ATEPI V Sbjct: 59 LLGPEEINWRNSYHGRCRDILAPYLDESEMAWLNKATEPIGV 100 >ref|XP_006389281.1| hypothetical protein POPTR_0031s00410g, partial [Populus trichocarpa] gi|550312033|gb|ERP48195.1| hypothetical protein POPTR_0031s00410g, partial [Populus trichocarpa] Length = 135 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LL PEEI+W N+YH RCR+IL+PY++++EMAWL ATEPI V Sbjct: 94 LLGPEEINWRNSYHGRCRDILAPYLDESEMAWLNKATEPIGV 135 >gb|EOX91163.1| Aminopeptidase P1 isoform 1 [Theobroma cacao] Length = 645 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPI 264 LLTP+EI WVN+YHS+CREIL PYM +M WL++ATEP+ Sbjct: 604 LLTPQEIEWVNSYHSKCREILEPYMEKHQMEWLKNATEPV 643 >ref|XP_004232381.1| PREDICTED: xaa-Pro aminopeptidase 1-like [Solanum lycopersicum] Length = 135 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPI 264 LL PEEI W+N YH++CREIL+PY+N +EM WL+ ATEPI Sbjct: 94 LLIPEEIEWLNEYHAKCREILTPYLNTSEMEWLKKATEPI 133 >ref|XP_002310789.1| predicted protein [Populus trichocarpa] Length = 261 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LL PEEI+W+N YH RCR+IL+PY++++EMAWL ATEPI V Sbjct: 220 LLGPEEINWLNIYHGRCRDILAPYLDESEMAWLNKATEPIGV 261 >ref|XP_006381257.1| hypothetical protein POPTR_0006s11120g [Populus trichocarpa] gi|550335958|gb|ERP59054.1| hypothetical protein POPTR_0006s11120g [Populus trichocarpa] Length = 88 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LL PEEI+W N+YH RCR+IL+PY++++EMAWL ATEPI V Sbjct: 47 LLGPEEINWRNSYHGRCRDILAPYLDESEMAWLNKATEPIRV 88 >ref|XP_006285193.1| hypothetical protein CARUB_v10006543mg [Capsella rubella] gi|482553898|gb|EOA18091.1| hypothetical protein CARUB_v10006543mg [Capsella rubella] Length = 645 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 380 LTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LT EEI W+N YHS+C++IL+P+MN TEM WL+ ATEP+ V Sbjct: 603 LTREEIDWLNTYHSKCKDILAPFMNQTEMEWLKKATEPVSV 643 >gb|AAN41402.1| aminopeptidase P [Arabidopsis thaliana] Length = 644 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 380 LTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LT EEI W+N YHS+C++IL+P+MN TEM WL+ ATEP+ V Sbjct: 602 LTREEIDWLNTYHSKCKDILAPFMNQTEMEWLKKATEPVSV 642 >ref|XP_003537557.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Glycine max] Length = 657 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPI 264 LL PEEI W+N+YHS CR+IL+PY+N+ E AWL+ ATEP+ Sbjct: 616 LLCPEEIDWLNSYHSTCRDILAPYLNEVENAWLKKATEPV 655 >ref|XP_002869024.1| ATAPP1 [Arabidopsis lyrata subsp. lyrata] gi|297314860|gb|EFH45283.1| ATAPP1 [Arabidopsis lyrata subsp. lyrata] Length = 623 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 380 LTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LT EEI W+N YHS+C++IL+P+MN TEM WL+ ATEP+ V Sbjct: 581 LTREEIDWLNTYHSKCKDILAPFMNQTEMEWLKKATEPVSV 621 >ref|NP_195394.4| aminopeptidase P1 [Arabidopsis thaliana] gi|332661298|gb|AEE86698.1| aminopeptidase P1 [Arabidopsis thaliana] Length = 645 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 380 LTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LT EEI W+N YHS+C++IL+P+MN TEM WL+ ATEP+ V Sbjct: 603 LTREEIDWLNTYHSKCKDILAPFMNQTEMEWLKKATEPVSV 643 >gb|AAS58497.1| aminopeptidase P short isoform [Arabidopsis thaliana] Length = 633 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 380 LTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LT EEI W+N YHS+C++IL+P+MN TEM WL+ ATEP+ V Sbjct: 591 LTREEIDWLNTYHSKCKDILAPFMNQTEMEWLKKATEPVSV 631 >emb|CAB16823.1| aminopeptidase-like protein [Arabidopsis thaliana] gi|7270625|emb|CAB80342.1| aminopeptidase-like protein [Arabidopsis thaliana] gi|209529771|gb|ACI49780.1| At4g36760 [Arabidopsis thaliana] Length = 634 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 380 LTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LT EEI W+N YHS+C++IL+P+MN TEM WL+ ATEP+ V Sbjct: 592 LTREEIDWLNTYHSKCKDILAPFMNQTEMEWLKKATEPVSV 632 >ref|XP_006662971.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Oryza brachyantha] Length = 580 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 383 LLTPEEISWVNNYHSRCREILSPYMNDTEMAWLRSATEPIDV 258 LLTP EI WVN YHS CR+IL PY+N+ E WLR ATEPI V Sbjct: 537 LLTPAEIEWVNAYHSDCRKILQPYLNEQEKEWLRKATEPITV 578