BLASTX nr result
ID: Achyranthes23_contig00024719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00024719 (608 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28884.1| Immunoglobulin E-set superfamily protein isoform ... 73 5e-11 ref|XP_004139545.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 73 5e-11 gb|ESW14513.1| hypothetical protein PHAVU_008G287600g [Phaseolus... 72 2e-10 ref|XP_003518574.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 72 2e-10 ref|XP_003545071.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 72 2e-10 gb|ESW26006.1| hypothetical protein PHAVU_003G083600g [Phaseolus... 71 2e-10 gb|ESW19649.1| hypothetical protein PHAVU_006G143100g [Phaseolus... 71 2e-10 gb|EOY28882.1| Immunoglobulin E-set superfamily protein isoform ... 71 2e-10 ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ri... 71 2e-10 gb|EOX93382.1| Immunoglobulin E-set superfamily protein [Theobro... 70 3e-10 ref|XP_004486219.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 70 3e-10 ref|XP_002278188.2| PREDICTED: rho GDP-dissociation inhibitor 1-... 70 3e-10 emb|CBI33110.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002308781.1| Rho GDP-dissociation inhibitor 1 family prot... 70 3e-10 emb|CAN83205.1| hypothetical protein VITISV_019936 [Vitis vinifera] 70 3e-10 gb|AFK42510.1| unknown [Lotus japonicus] 70 4e-10 ref|XP_003610517.1| RHO protein GDP dissociation inhibitor [Medi... 70 4e-10 ref|XP_006587979.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 69 8e-10 ref|XP_003546181.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 69 8e-10 ref|XP_002322530.2| Rho GDP-dissociation inhibitor 1 family prot... 69 1e-09 >gb|EOY28884.1| Immunoglobulin E-set superfamily protein isoform 3 [Theobroma cacao] Length = 249 Score = 73.2 bits (178), Expect = 5e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEMLGTFSPQAE Y HEM EETTPSG F+RGSY+A+SK Sbjct: 185 DSTKEMLGTFSPQAEPYTHEMPEETTPSGMFARGSYSARSK 225 >ref|XP_004139545.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] gi|449508966|ref|XP_004163456.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] Length = 259 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEM+GTFSPQ E Y HEMQEETTPSG F+RGSY+A+SK Sbjct: 191 DSTKEMIGTFSPQPEPYDHEMQEETTPSGIFARGSYSARSK 231 >gb|ESW14513.1| hypothetical protein PHAVU_008G287600g [Phaseolus vulgaris] Length = 227 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEMLGTFSPQ EAY HEM EETTPSG F+RGSY+A+SK Sbjct: 164 DSSKEMLGTFSPQPEAYTHEMPEETTPSGLFARGSYSARSK 204 >ref|XP_003518574.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Glycine max] Length = 233 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEMLGTFSPQAE Y HEM EETTPSG F+RGSY+A+SK Sbjct: 170 DSSKEMLGTFSPQAEPYTHEMPEETTPSGLFARGSYSARSK 210 >ref|XP_003545071.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Glycine max] Length = 227 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEMLGTFSPQAE Y HEM EETTPSG F+RGSY+A+SK Sbjct: 164 DSSKEMLGTFSPQAEPYTHEMPEETTPSGLFARGSYSARSK 204 >gb|ESW26006.1| hypothetical protein PHAVU_003G083600g [Phaseolus vulgaris] Length = 249 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEM+GTFSPQAE Y HEM EETTPSG F+RG+Y+A+SK Sbjct: 186 DSTKEMIGTFSPQAEPYTHEMPEETTPSGLFARGTYSARSK 226 >gb|ESW19649.1| hypothetical protein PHAVU_006G143100g [Phaseolus vulgaris] Length = 349 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEM+GTFSPQAE Y HEM EETTPSG F+RG+Y+A+SK Sbjct: 286 DSTKEMIGTFSPQAEPYTHEMPEETTPSGMFARGAYSARSK 326 >gb|EOY28882.1| Immunoglobulin E-set superfamily protein isoform 1 [Theobroma cacao] Length = 305 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKS 122 DSTKEMLGTFSPQAE Y HEM EETTPSG F+RGSY+A+S Sbjct: 185 DSTKEMLGTFSPQAEPYTHEMPEETTPSGMFARGSYSARS 224 >ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223540220|gb|EEF41793.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 243 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS KEMLGTFSPQAE Y HEM EETTPSG F+RGSY+A+SK Sbjct: 178 DSAKEMLGTFSPQAEPYTHEMPEETTPSGIFARGSYSARSK 218 >gb|EOX93382.1| Immunoglobulin E-set superfamily protein [Theobroma cacao] Length = 253 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 STKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 STKEM+GTFSPQ E Y HEM EET PSG+F+RGSYTAKSK Sbjct: 188 STKEMIGTFSPQLEPYTHEMPEETAPSGFFARGSYTAKSK 227 >ref|XP_004486219.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cicer arietinum] Length = 241 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS KEM+GTFSPQ E Y HEM EETTPSG F+RG+YTAKSK Sbjct: 178 DSCKEMIGTFSPQTETYAHEMPEETTPSGLFARGAYTAKSK 218 >ref|XP_002278188.2| PREDICTED: rho GDP-dissociation inhibitor 1-like [Vitis vinifera] Length = 245 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEMLGTFSPQ E Y HEM EETTPSG F+RG+Y+AK+K Sbjct: 181 DSTKEMLGTFSPQQETYTHEMPEETTPSGIFARGTYSAKTK 221 >emb|CBI33110.3| unnamed protein product [Vitis vinifera] Length = 232 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEMLGTFSPQ E Y HEM EETTPSG F+RG+Y+AK+K Sbjct: 168 DSTKEMLGTFSPQQETYTHEMPEETTPSGIFARGTYSAKTK 208 >ref|XP_002308781.1| Rho GDP-dissociation inhibitor 1 family protein [Populus trichocarpa] gi|222854757|gb|EEE92304.1| Rho GDP-dissociation inhibitor 1 family protein [Populus trichocarpa] Length = 243 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEM+GTFSPQAE Y HEM EETTPSG F+RGSY AK+K Sbjct: 176 DSSKEMIGTFSPQAEPYTHEMPEETTPSGIFARGSYAAKTK 216 >emb|CAN83205.1| hypothetical protein VITISV_019936 [Vitis vinifera] Length = 191 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEMLGTFSPQ E Y HEM EETTPSG F+RG+Y+AK+K Sbjct: 127 DSTKEMLGTFSPQQETYTHEMPEETTPSGIFARGTYSAKTK 167 >gb|AFK42510.1| unknown [Lotus japonicus] Length = 242 Score = 70.1 bits (170), Expect = 4e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEM+GTFSPQAE Y HEM EETTPSG F+RG+Y+A++K Sbjct: 179 DSTKEMIGTFSPQAEPYTHEMPEETTPSGIFARGTYSARTK 219 >ref|XP_003610517.1| RHO protein GDP dissociation inhibitor [Medicago truncatula] gi|355511572|gb|AES92714.1| RHO protein GDP dissociation inhibitor [Medicago truncatula] Length = 222 Score = 70.1 bits (170), Expect = 4e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DSTKEM+GTFSPQAE Y HEM EETTPSG F+RG+Y+A++K Sbjct: 159 DSTKEMIGTFSPQAEPYTHEMPEETTPSGLFARGTYSARTK 199 >ref|XP_006587979.1| PREDICTED: rho GDP-dissociation inhibitor 1-like, partial [Glycine max] Length = 230 Score = 69.3 bits (168), Expect = 8e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEM+GTFSPQAE Y HEM EETTPSG F+RG Y+A+SK Sbjct: 167 DSSKEMIGTFSPQAEPYTHEMPEETTPSGMFARGQYSARSK 207 >ref|XP_003546181.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Glycine max] Length = 255 Score = 69.3 bits (168), Expect = 8e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEM+GTFSPQAE Y HEM EETTPSG F+RG Y+A+SK Sbjct: 192 DSSKEMIGTFSPQAEPYTHEMPEETTPSGMFARGQYSARSK 232 >ref|XP_002322530.2| Rho GDP-dissociation inhibitor 1 family protein [Populus trichocarpa] gi|550320574|gb|EEF04291.2| Rho GDP-dissociation inhibitor 1 family protein [Populus trichocarpa] Length = 257 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 DSTKEMLGTFSPQAEAYHHEMQEETTPSGYFSRGSYTAKSK 125 DS+KEM+GTFSPQ E Y HEM EETTPSG F+RGSY A+SK Sbjct: 190 DSSKEMIGTFSPQTEPYTHEMPEETTPSGMFARGSYAARSK 230