BLASTX nr result
ID: Achyranthes23_contig00024113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00024113 (219 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY27850.1| Eukaryotic translation initiation factor 4E-1 iso... 57 3e-06 gb|EOY27849.1| Eukaryotic translation initiation factor 4E-1 iso... 57 3e-06 >gb|EOY27850.1| Eukaryotic translation initiation factor 4E-1 isoform 2 [Theobroma cacao] Length = 234 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 120 TAENPSKGIVASTHPLENSWTFWFDNPSAKSKQ 218 T+ + KG+V HPLE+SWTFWFDNPSAKSKQ Sbjct: 45 TSSSSKKGVVEQPHPLEHSWTFWFDNPSAKSKQ 77 >gb|EOY27849.1| Eukaryotic translation initiation factor 4E-1 isoform 1 [Theobroma cacao] Length = 233 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 120 TAENPSKGIVASTHPLENSWTFWFDNPSAKSKQ 218 T+ + KG+V HPLE+SWTFWFDNPSAKSKQ Sbjct: 45 TSSSSKKGVVEQPHPLEHSWTFWFDNPSAKSKQ 77