BLASTX nr result
ID: Achyranthes23_contig00024102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00024102 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006604489.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 70 4e-10 ref|XP_004289938.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 70 4e-10 ref|XP_003554286.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 70 4e-10 ref|XP_006479547.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 67 2e-09 ref|XP_006443844.1| hypothetical protein CICLE_v10023734mg [Citr... 67 2e-09 gb|AFK42290.1| unknown [Lotus japonicus] 67 2e-09 gb|AFK34219.1| unknown [Lotus japonicus] 67 2e-09 ref|XP_006576939.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 65 7e-09 ref|XP_002306848.1| hypothetical protein POPTR_0005s24540g [Popu... 64 2e-08 gb|EMJ01070.1| hypothetical protein PRUPE_ppa006051mg [Prunus pe... 64 3e-08 gb|ESW34536.1| hypothetical protein PHAVU_001G160800g [Phaseolus... 63 4e-08 ref|XP_004493774.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 63 4e-08 ref|XP_002524618.1| conserved hypothetical protein [Ricinus comm... 63 5e-08 ref|XP_004148953.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 62 6e-08 ref|XP_006338195.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 62 8e-08 ref|XP_006338194.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 62 8e-08 ref|XP_003541354.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 62 8e-08 gb|ESW16894.1| hypothetical protein PHAVU_007G193000g [Phaseolus... 61 1e-07 emb|CBI37113.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002273202.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 61 1e-07 >ref|XP_006604489.1| PREDICTED: UPF0420 protein C16orf58 homolog isoform X2 [Glycine max] Length = 372 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRFT 170 YA+ E+S +L+ EAYEKM VFP FL ELQ+KGWHTDRFLDGTG RF+ Sbjct: 317 YAARTESSSHELSATSV-LHEAYEKMNGVFPVFLRELQNKGWHTDRFLDGTGSRFS 371 >ref|XP_004289938.1| PREDICTED: UPF0420 protein C16orf58 homolog [Fragaria vesca subsp. vesca] Length = 437 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/55 (63%), Positives = 39/55 (70%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+ E SF P T EAYEKM +VF F+SELQ+KGWHTDRFLDGTG RF Sbjct: 383 YAADMEKSFHV--PTSTALEEAYEKMNDVFGPFISELQAKGWHTDRFLDGTGSRF 435 >ref|XP_003554286.1| PREDICTED: UPF0420 protein C16orf58 homolog isoform X1 [Glycine max] Length = 419 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRFT 170 YA+ E+S +L+ EAYEKM VFP FL ELQ+KGWHTDRFLDGTG RF+ Sbjct: 364 YAARTESSSHELSATSV-LHEAYEKMNGVFPVFLRELQNKGWHTDRFLDGTGSRFS 418 >ref|XP_006479547.1| PREDICTED: UPF0420 protein C16orf58 homolog [Citrus sinensis] Length = 432 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+S SF D P+ T +AY+KM +VF LSELQ+KGWHTDRFLDGTG RF Sbjct: 378 YAASMAKSFHD--PSLTVLQDAYDKMNDVFTPLLSELQAKGWHTDRFLDGTGTRF 430 >ref|XP_006443844.1| hypothetical protein CICLE_v10023734mg [Citrus clementina] gi|557546106|gb|ESR57084.1| hypothetical protein CICLE_v10023734mg [Citrus clementina] Length = 454 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+S SF D P+ T +AY+KM +VF LSELQ+KGWHTDRFLDGTG RF Sbjct: 400 YAASMAKSFHD--PSLTVLQDAYDKMNDVFTPLLSELQAKGWHTDRFLDGTGTRF 452 >gb|AFK42290.1| unknown [Lotus japonicus] Length = 414 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+ E S +L+ + EAY+KM VFP FL ELQSKGWHTDRFLDGTG RF Sbjct: 360 YAAQIENSSHELSASV--LHEAYKKMTGVFPVFLKELQSKGWHTDRFLDGTGSRF 412 >gb|AFK34219.1| unknown [Lotus japonicus] Length = 182 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+ E S +L+ + EAY+KM VFP FL ELQSKGWHTDRFLDGTG RF Sbjct: 128 YAAQIENSSHELSASV--LHEAYKKMTGVFPVFLKELQSKGWHTDRFLDGTGSRF 180 >ref|XP_006576939.1| PREDICTED: UPF0420 protein C16orf58 homolog [Glycine max] Length = 419 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 63 EAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 EAYEKM VFP FL ELQ+KGWHTDRFLDGTG RF Sbjct: 383 EAYEKMNGVFPVFLRELQNKGWHTDRFLDGTGSRF 417 >ref|XP_002306848.1| hypothetical protein POPTR_0005s24540g [Populus trichocarpa] gi|222856297|gb|EEE93844.1| hypothetical protein POPTR_0005s24540g [Populus trichocarpa] Length = 428 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 63 EAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRFT 170 +AYEKM +VF FLSELQ+KGWHTDRFLDGTG RF+ Sbjct: 392 DAYEKMNSVFDPFLSELQAKGWHTDRFLDGTGSRFS 427 >gb|EMJ01070.1| hypothetical protein PRUPE_ppa006051mg [Prunus persica] Length = 430 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+ E SF P+ EAYE M +V+ F+SELQ+KGWHTDRFLDGTG RF Sbjct: 376 YAAHIEKSFGV--PSSCALQEAYENMNDVYGPFVSELQAKGWHTDRFLDGTGSRF 428 >gb|ESW34536.1| hypothetical protein PHAVU_001G160800g [Phaseolus vulgaris] Length = 419 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 63 EAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 EAYEKM VFP FL ELQ+KGW+TDRFLDGTG RF Sbjct: 383 EAYEKMNGVFPIFLKELQNKGWYTDRFLDGTGSRF 417 >ref|XP_004493774.1| PREDICTED: UPF0420 protein C16orf58 homolog [Cicer arietinum] Length = 415 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 +A NE+S +L+ + EAY KM VF FL ELQ+KGWHTDRFLDGTG RF Sbjct: 361 FAEQNESSSHELSASVLQ--EAYGKMNGVFHVFLKELQNKGWHTDRFLDGTGSRF 413 >ref|XP_002524618.1| conserved hypothetical protein [Ricinus communis] gi|223536171|gb|EEF37826.1| conserved hypothetical protein [Ricinus communis] Length = 436 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA+S E S P+ +AYEKM + F FLSELQ+KGWHTDRFLDG G RF Sbjct: 382 YATSMEKSSHMCTPSVLQ--DAYEKMNSTFDSFLSELQAKGWHTDRFLDGVGSRF 434 >ref|XP_004148953.1| PREDICTED: UPF0420 protein C16orf58 homolog [Cucumis sativus] Length = 428 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 42 PNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 P + EAYEKM +VF FLSELQ+KGW+TDRFLDG G RF Sbjct: 385 PTASVLLEAYEKMNDVFTPFLSELQAKGWYTDRFLDGAGSRF 426 >ref|XP_006338195.1| PREDICTED: UPF0420 protein C16orf58 homolog isoform X2 [Solanum tuberosum] Length = 411 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YAS E + P+ EAY+KM + F FL+ELQ+KGWHTDRFLDGTG RF Sbjct: 357 YASDMERLVHE--PSANILQEAYDKMNSTFSPFLAELQAKGWHTDRFLDGTGNRF 409 >ref|XP_006338194.1| PREDICTED: UPF0420 protein C16orf58 homolog isoform X1 [Solanum tuberosum] Length = 429 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YAS E + P+ EAY+KM + F FL+ELQ+KGWHTDRFLDGTG RF Sbjct: 375 YASDMERLVHE--PSANILQEAYDKMNSTFSPFLAELQAKGWHTDRFLDGTGNRF 427 >ref|XP_003541354.1| PREDICTED: UPF0420 protein C16orf58 homolog [Glycine max] Length = 431 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 63 EAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 +AYEKM VFP F+ ELQ KGWHTDRFLDG+G RF Sbjct: 395 QAYEKMNEVFPAFIKELQCKGWHTDRFLDGSGCRF 429 >gb|ESW16894.1| hypothetical protein PHAVU_007G193000g [Phaseolus vulgaris] Length = 428 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = +3 Query: 3 YASSNETSFDDLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 YA + S +L+ N T +AYEKM VFP FL EL+ KGWHTDRFLDG+G RF Sbjct: 374 YAVQIDKSSHELS-NST-LLQAYEKMNEVFPLFLKELECKGWHTDRFLDGSGSRF 426 >emb|CBI37113.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 33 DLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 D P+ T EAY+KM +VF F+S+LQ+KGWHTD FLDGTG RF Sbjct: 378 DHEPSMTVLQEAYDKMNSVFSTFVSKLQAKGWHTDCFLDGTGSRF 422 >ref|XP_002273202.1| PREDICTED: UPF0420 protein C16orf58 homolog [Vitis vinifera] Length = 420 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 33 DLNPNPTGFFEAYEKMENVFPEFLSELQSKGWHTDRFLDGTGYRF 167 D P+ T EAY+KM +VF F+S+LQ+KGWHTD FLDGTG RF Sbjct: 374 DHEPSMTVLQEAYDKMNSVFSTFVSKLQAKGWHTDCFLDGTGSRF 418