BLASTX nr result
ID: Achyranthes23_contig00024075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00024075 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265293.1| PREDICTED: heat stress transcription factor ... 103 3e-20 ref|XP_003556931.1| PREDICTED: heat stress transcription factor ... 102 7e-20 gb|ACU21168.1| unknown [Glycine max] 102 7e-20 ref|XP_002533289.1| conserved hypothetical protein [Ricinus comm... 100 3e-19 gb|EOY32868.1| Heat shock transcription factor B4 [Theobroma cacao] 98 1e-18 ref|XP_002314009.1| hypothetical protein POPTR_0009s07220g [Popu... 98 1e-18 gb|EXB37178.1| Heat stress transcription factor B-4 [Morus notab... 98 1e-18 ref|XP_003617219.1| Heat stress transcription factor B-4 [Medica... 98 1e-18 ref|XP_002298460.1| hypothetical protein POPTR_0001s28040g [Popu... 97 2e-18 gb|EMJ27687.1| hypothetical protein PRUPE_ppa026635mg [Prunus pe... 97 2e-18 ref|XP_002510200.1| DNA binding protein, putative [Ricinus commu... 97 2e-18 gb|ESW18134.1| hypothetical protein PHAVU_006G015700g [Phaseolus... 97 3e-18 ref|XP_004491224.1| PREDICTED: heat stress transcription factor ... 97 3e-18 ref|XP_006829889.1| hypothetical protein AMTR_s00073p00033500 [A... 96 4e-18 ref|XP_004501560.1| PREDICTED: heat stress transcription factor ... 96 4e-18 ref|XP_006354868.1| PREDICTED: heat stress transcription factor ... 96 5e-18 ref|XP_004238144.1| PREDICTED: heat stress transcription factor ... 96 5e-18 ref|XP_003603058.1| Heat stress transcription factor B-4 [Medica... 96 5e-18 gb|EXC32846.1| Heat stress transcription factor B-4 [Morus notab... 96 7e-18 gb|ESW08686.1| hypothetical protein PHAVU_009G065800g [Phaseolus... 96 7e-18 >ref|XP_002265293.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|296083885|emb|CBI24273.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 103 bits (256), Expect = 3e-20 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVFSV ESQK+VPAPFLTKTYQLVDDP TDHIVSWGEDE TFVVWRPPEFARD Sbjct: 11 MVFSV-ESQKAVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEFARD 62 >ref|XP_003556931.1| PREDICTED: heat stress transcription factor B-4-like [Glycine max] Length = 271 Score = 102 bits (253), Expect = 7e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF++ ESQKSVPAPFLTKTYQLVDDP TDHIVSWGEDE TFVVWRPPEFARD Sbjct: 12 MVFTL-ESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEFARD 63 >gb|ACU21168.1| unknown [Glycine max] Length = 271 Score = 102 bits (253), Expect = 7e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF++ ESQKSVPAPFLTKTYQLVDDP TDHIVSWGEDE TFVVWRPPEFARD Sbjct: 12 MVFTL-ESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEFARD 63 >ref|XP_002533289.1| conserved hypothetical protein [Ricinus communis] gi|223526892|gb|EEF29100.1| conserved hypothetical protein [Ricinus communis] Length = 191 Score = 100 bits (248), Expect = 3e-19 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVFSV ESQK+VPAPFLTKTYQLVDDP TDHIVSWG+D+ TFVVWRPPEFARD Sbjct: 11 MVFSV-ESQKAVPAPFLTKTYQLVDDPLTDHIVSWGDDQTTFVVWRPPEFARD 62 >gb|EOY32868.1| Heat shock transcription factor B4 [Theobroma cacao] Length = 279 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +VFSV ESQK+VPAPFL+KTYQLVDDP TDHIVSWGEDE +FVVWRPPEFARD Sbjct: 11 LVFSV-ESQKAVPAPFLSKTYQLVDDPLTDHIVSWGEDETSFVVWRPPEFARD 62 >ref|XP_002314009.1| hypothetical protein POPTR_0009s07220g [Populus trichocarpa] gi|222850417|gb|EEE87964.1| hypothetical protein POPTR_0009s07220g [Populus trichocarpa] Length = 272 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF+V ESQK+VPAPFLTKTYQLVDDP TDH+VSWG+DE TFVVWRPPEFAR+ Sbjct: 11 MVFTV-ESQKAVPAPFLTKTYQLVDDPLTDHVVSWGDDETTFVVWRPPEFARE 62 >gb|EXB37178.1| Heat stress transcription factor B-4 [Morus notabilis] Length = 299 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF+V ESQK+VPAPFLTKTYQLVDDP TDH+VSWG+D TFVVWRPPEFARD Sbjct: 1 MVFTV-ESQKAVPAPFLTKTYQLVDDPLTDHVVSWGDDHTTFVVWRPPEFARD 52 >ref|XP_003617219.1| Heat stress transcription factor B-4 [Medicago truncatula] gi|355518554|gb|AET00178.1| Heat stress transcription factor B-4 [Medicago truncatula] Length = 254 Score = 97.8 bits (242), Expect = 1e-18 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF++ ESQKSVPAPFLTKTYQLVDDP TDHIVSW +DE TFVVWRPPEFARD Sbjct: 12 MVFTM-ESQKSVPAPFLTKTYQLVDDPLTDHIVSWSDDETTFVVWRPPEFARD 63 >ref|XP_002298460.1| hypothetical protein POPTR_0001s28040g [Populus trichocarpa] gi|222845718|gb|EEE83265.1| hypothetical protein POPTR_0001s28040g [Populus trichocarpa] Length = 270 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF+V ESQK+VPAPFLTKTYQLVDDP TDHIVSWG+DE +FVVWRPPEF+RD Sbjct: 11 MVFTV-ESQKAVPAPFLTKTYQLVDDPLTDHIVSWGDDETSFVVWRPPEFSRD 62 >gb|EMJ27687.1| hypothetical protein PRUPE_ppa026635mg [Prunus persica] Length = 389 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED+ATFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFARD 62 >ref|XP_002510200.1| DNA binding protein, putative [Ricinus communis] gi|223550901|gb|EEF52387.1| DNA binding protein, putative [Ricinus communis] Length = 362 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED+ATFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFARD 62 >gb|ESW18134.1| hypothetical protein PHAVU_006G015700g [Phaseolus vulgaris] Length = 269 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVFS E+QKSVPAPFLTKTYQLV+DP TDHIVSWGED+ TFVVWRPPEF+RD Sbjct: 12 MVFSF-ETQKSVPAPFLTKTYQLVEDPLTDHIVSWGEDDTTFVVWRPPEFSRD 63 >ref|XP_004491224.1| PREDICTED: heat stress transcription factor B-4b-like [Cicer arietinum] Length = 257 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -3 Query: 160 MVFSVSESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 MVF++ ESQKSVPAPFL KTYQLVDDP TDHIVSWG+D+ TFVVWRPPEFARD Sbjct: 13 MVFTM-ESQKSVPAPFLIKTYQLVDDPLTDHIVSWGDDQTTFVVWRPPEFARD 64 >ref|XP_006829889.1| hypothetical protein AMTR_s00073p00033500 [Amborella trichopoda] gi|548835501|gb|ERM97305.1| hypothetical protein AMTR_s00073p00033500 [Amborella trichopoda] Length = 341 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 ES KSVPAPFLTKTYQLVDDP TDHIVSWGED +TFVVWRPPEFARD Sbjct: 16 ESHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDHSTFVVWRPPEFARD 62 >ref|XP_004501560.1| PREDICTED: heat stress transcription factor B-4-like [Cicer arietinum] Length = 375 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED++TFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPNTDHIVSWGEDDSTFVVWRPPEFARD 62 >ref|XP_006354868.1| PREDICTED: heat stress transcription factor B-4-like [Solanum tuberosum] Length = 372 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED++TFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFARD 62 >ref|XP_004238144.1| PREDICTED: heat stress transcription factor B-4-like [Solanum lycopersicum] Length = 360 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED++TFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFARD 62 >ref|XP_003603058.1| Heat stress transcription factor B-4 [Medicago truncatula] gi|355492106|gb|AES73309.1| Heat stress transcription factor B-4 [Medicago truncatula] Length = 373 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED++TFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDSTFVVWRPPEFARD 62 >gb|EXC32846.1| Heat stress transcription factor B-4 [Morus notabilis] Length = 394 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED+ TFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFARD 62 >gb|ESW08686.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] Length = 364 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -3 Query: 142 ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDEATFVVWRPPEFARD 2 +S KSVPAPFLTKTYQLVDDP TDHIVSWGED+ TFVVWRPPEFARD Sbjct: 16 DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARD 62