BLASTX nr result
ID: Achyranthes23_contig00023917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00023917 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK39204.1| unknown [Lotus japonicus] 58 1e-06 ref|XP_006414113.1| hypothetical protein EUTSA_v10026609mg [Eutr... 57 2e-06 ref|XP_002868000.1| hypothetical protein ARALYDRAFT_914851 [Arab... 57 2e-06 ref|XP_006285662.1| hypothetical protein CARUB_v10007117mg [Caps... 57 3e-06 ref|NP_680719.1| Small nuclear ribonucleoprotein family protein ... 56 4e-06 ref|XP_002519649.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 gb|AAR24165.1| At4g18372 [Arabidopsis thaliana] gi|40823882|gb|A... 56 4e-06 gb|EXB54844.1| hypothetical protein L484_005333 [Morus notabilis] 56 6e-06 ref|NP_001058358.1| Os06g0677600 [Oryza sativa Japonica Group] g... 56 6e-06 gb|EPS70464.1| hypothetical protein M569_04303, partial [Genlise... 55 7e-06 emb|CBI20780.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_002282858.1| PREDICTED: uncharacterized protein LOC100262... 55 7e-06 ref|XP_004244972.1| PREDICTED: small nuclear ribonucleoprotein-a... 55 9e-06 ref|XP_002322446.1| small nuclear ribonucleoprotein [Populus tri... 55 9e-06 >gb|AFK39204.1| unknown [Lotus japonicus] Length = 111 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLKD 101 R LGLILIPSSCR TCH+DCS++EQ+ LLSL++ Sbjct: 78 RCLGLILIPSSCRATCHVDCSIDEQLSLLSLRE 110 >ref|XP_006414113.1| hypothetical protein EUTSA_v10026609mg [Eutrema salsugineum] gi|557115283|gb|ESQ55566.1| hypothetical protein EUTSA_v10026609mg [Eutrema salsugineum] Length = 112 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLKD 101 R LG+ILIPSSCRT+CH+DCS+EEQ+ L+ LK+ Sbjct: 80 RCLGMILIPSSCRTSCHVDCSIEEQLSLIQLKE 112 >ref|XP_002868000.1| hypothetical protein ARALYDRAFT_914851 [Arabidopsis lyrata subsp. lyrata] gi|297313836|gb|EFH44259.1| hypothetical protein ARALYDRAFT_914851 [Arabidopsis lyrata subsp. lyrata] Length = 112 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLKD 101 R LG+ILIPSSCRT+CH+DCS+EEQ+ L+ LK+ Sbjct: 80 RCLGMILIPSSCRTSCHVDCSIEEQLSLIQLKE 112 >ref|XP_006285662.1| hypothetical protein CARUB_v10007117mg [Capsella rubella] gi|482554367|gb|EOA18560.1| hypothetical protein CARUB_v10007117mg [Capsella rubella] Length = 109 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLK 98 R LG+ILIPSSCRT+CH+DCS+EEQ+ L+ LK Sbjct: 77 RCLGMILIPSSCRTSCHVDCSIEEQLSLIQLK 108 >ref|NP_680719.1| Small nuclear ribonucleoprotein family protein [Arabidopsis thaliana] gi|332658634|gb|AEE84034.1| Small nuclear ribonucleoprotein family protein [Arabidopsis thaliana] Length = 112 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLKD 101 R LG+ILIPSSCRT+CH+DCS++EQ+ L+ LK+ Sbjct: 80 RCLGMILIPSSCRTSCHVDCSIDEQLSLIQLKE 112 >ref|XP_002519649.1| conserved hypothetical protein [Ricinus communis] gi|223541066|gb|EEF42622.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLKD 101 R LGLILIP+SCRTTCH+DCS+EEQ+ L L++ Sbjct: 86 RCLGLILIPASCRTTCHVDCSIEEQLSLFKLQE 118 >gb|AAR24165.1| At4g18372 [Arabidopsis thaliana] gi|40823882|gb|AAR92310.1| At4g18372 [Arabidopsis thaliana] Length = 78 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLKD 101 R LG+ILIPSSCRT+CH+DCS++EQ+ L+ LK+ Sbjct: 46 RCLGMILIPSSCRTSCHVDCSIDEQLSLIQLKE 78 >gb|EXB54844.1| hypothetical protein L484_005333 [Morus notabilis] Length = 104 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSL 95 R LGLILIPSSCR++CH+DCSVEEQ+ LLS+ Sbjct: 74 RCLGLILIPSSCRSSCHVDCSVEEQLSLLSI 104 >ref|NP_001058358.1| Os06g0677600 [Oryza sativa Japonica Group] gi|52076623|dbj|BAD45524.1| small nuclear ribonucleoprotein-like [Oryza sativa Japonica Group] gi|52076909|dbj|BAD45921.1| small nuclear ribonucleoprotein-like [Oryza sativa Japonica Group] gi|113596398|dbj|BAF20272.1| Os06g0677600 [Oryza sativa Japonica Group] gi|125556469|gb|EAZ02075.1| hypothetical protein OsI_24156 [Oryza sativa Indica Group] gi|125598231|gb|EAZ38011.1| hypothetical protein OsJ_22356 [Oryza sativa Japonica Group] gi|215693232|dbj|BAG88614.1| unnamed protein product [Oryza sativa Japonica Group] Length = 116 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSL 95 RGLGLILIP++CR++CH+DC+VEE M LLSL Sbjct: 84 RGLGLILIPAACRSSCHVDCAVEESMSLLSL 114 >gb|EPS70464.1| hypothetical protein M569_04303, partial [Genlisea aurea] Length = 101 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSL 95 RG+GLILIPS+CR +CH+DCS++EQ+ LLSL Sbjct: 67 RGVGLILIPSTCRISCHVDCSIDEQLSLLSL 97 >emb|CBI20780.3| unnamed protein product [Vitis vinifera] Length = 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSL 95 R LGLILIP SCRT+CH+DCS+EEQ+ LLSL Sbjct: 46 RCLGLILIPFSCRTSCHVDCSIEEQLSLLSL 76 >ref|XP_002282858.1| PREDICTED: uncharacterized protein LOC100262900 [Vitis vinifera] Length = 116 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSL 95 R LGLILIP SCRT+CH+DCS+EEQ+ LLSL Sbjct: 84 RCLGLILIPFSCRTSCHVDCSIEEQLSLLSL 114 >ref|XP_004244972.1| PREDICTED: small nuclear ribonucleoprotein-associated protein N-like isoform 1 [Solanum lycopersicum] gi|460398877|ref|XP_004244973.1| PREDICTED: small nuclear ribonucleoprotein-associated protein N-like isoform 2 [Solanum lycopersicum] Length = 118 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSL 95 R LGLILIPSSCR TCH+DCS++EQ+ L+SL Sbjct: 83 RVLGLILIPSSCRKTCHVDCSIDEQLSLMSL 113 >ref|XP_002322446.1| small nuclear ribonucleoprotein [Populus trichocarpa] gi|222869442|gb|EEF06573.1| small nuclear ribonucleoprotein [Populus trichocarpa] Length = 109 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 3 RGLGLILIPSSCRTTCHIDCSVEEQMELLSLK 98 R LGLILIPSSCRT+CH+DCS+EEQ+ LL + Sbjct: 78 RCLGLILIPSSCRTSCHVDCSIEEQLSLLKFQ 109