BLASTX nr result
ID: Achyranthes23_contig00023746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00023746 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632537.1| PREDICTED: beta-galactosidase 3-like [Vitis ... 59 5e-07 >ref|XP_003632537.1| PREDICTED: beta-galactosidase 3-like [Vitis vinifera] gi|296082595|emb|CBI21600.3| unnamed protein product [Vitis vinifera] Length = 847 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 128 GPFHEWVGAG*TGAVIKGLNNEILNLTKYK*TYKVGLLGENL 3 GPF+EWVGAG T IKGLNN I++L+ Y TYK+GL GE+L Sbjct: 558 GPFYEWVGAGLTSVKIKGLNNGIMDLSTYTWTYKIGLQGEHL 599