BLASTX nr result
ID: Achyranthes23_contig00023658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00023658 (639 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512592.1| flap endonuclease-1, putative [Ricinus commu... 58 2e-06 ref|XP_002278964.2| PREDICTED: flap endonuclease 1-like [Vitis v... 56 8e-06 emb|CAN76592.1| hypothetical protein VITISV_020294 [Vitis vinifera] 56 8e-06 >ref|XP_002512592.1| flap endonuclease-1, putative [Ricinus communis] gi|223548553|gb|EEF50044.1| flap endonuclease-1, putative [Ricinus communis] Length = 345 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 AKSKSSQGRLESFFKPVSTGSIPIKRKGKVDNTSKQTS 114 AK+KSSQGRLESFFKPV+ SIPIKRK D+T+K+TS Sbjct: 295 AKNKSSQGRLESFFKPVANSSIPIKRKETPDHTAKETS 332 >ref|XP_002278964.2| PREDICTED: flap endonuclease 1-like [Vitis vinifera] Length = 384 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 1 AKSKSSQGRLESFFKPVSTGSIPIKRKGKVDNTSKQTSN 117 AK+KSSQGRLESFFKPV + SIPIKRK D +K+T+N Sbjct: 333 AKNKSSQGRLESFFKPVVSSSIPIKRKETEDKAAKETTN 371 >emb|CAN76592.1| hypothetical protein VITISV_020294 [Vitis vinifera] Length = 978 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 1 AKSKSSQGRLESFFKPVSTGSIPIKRKGKVDNTSKQTSN 117 AK+KSSQGRLESFFKPV + SIPIKRK D +K+T+N Sbjct: 330 AKNKSSQGRLESFFKPVVSSSIPIKRKETEDKAAKETTN 368