BLASTX nr result
ID: Achyranthes23_contig00023437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00023437 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK14395.1|AF339732_1 response regulator protein [Dianthus ca... 87 2e-15 ref|XP_002312699.2| hypothetical protein POPTR_0008s19730g [Popu... 71 2e-10 emb|CBX43984.1| putative A-type response regulator 2 [Populus x ... 70 2e-10 gb|ABK96781.1| unknown [Populus trichocarpa x Populus deltoides] 70 2e-10 ref|XP_002520201.1| two-component sensor protein histidine prote... 67 2e-09 gb|EXB82664.1| Two-component response regulator [Morus notabilis] 66 5e-09 ref|XP_002312769.1| type-a response regulator [Populus trichocar... 64 2e-08 gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma ... 64 2e-08 ref|XP_004297679.1| PREDICTED: two-component response regulator ... 63 3e-08 emb|CBI32076.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_004238726.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 62 1e-07 emb|CBX43983.1| putative A-type response regulator 1b [Populus x... 62 1e-07 emb|CBX43982.1| putative A-type response regulator 1a [Populus x... 62 1e-07 ref|XP_006357275.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 61 1e-07 ref|XP_006483757.1| PREDICTED: two-component response regulator ... 60 2e-07 gb|EMJ25075.1| hypothetical protein PRUPE_ppa010863mg [Prunus pe... 60 3e-07 ref|XP_003519320.1| PREDICTED: two-component response regulator ... 60 3e-07 emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera] 60 3e-07 dbj|BAL43556.1| type-A response regulator [Petunia x hybrida] 59 5e-07 ref|XP_003517746.1| PREDICTED: two-component response regulator ... 59 5e-07 >gb|AAK14395.1|AF339732_1 response regulator protein [Dianthus caryophyllus] Length = 264 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/58 (74%), Positives = 46/58 (79%) Frame = -2 Query: 177 RNAVVSNRRWMSDSAIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 RN VVS RRW SD+ I+ PSD EAHVLAVDDS +DRKVIE LLKTTSCKVT VDS Sbjct: 9 RNGVVSTRRWKSDTCIDLGPSDVRSEAHVLAVDDSLIDRKVIERLLKTTSCKVTVVDS 66 >ref|XP_002312699.2| hypothetical protein POPTR_0008s19730g [Populus trichocarpa] gi|550333486|gb|EEE90066.2| hypothetical protein POPTR_0008s19730g [Populus trichocarpa] Length = 247 Score = 70.9 bits (172), Expect = 2e-10 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 6/66 (9%) Frame = -2 Query: 183 MGRNAVVSNRRWMSD--SAIEFLPS----DAHVEAHVLAVDDSFVDRKVIETLLKTTSCK 22 MG N+VVSNR WMS+ + ++ P+ + E HVLAVDDSFVDRKVIE LLK +SCK Sbjct: 1 MGSNSVVSNR-WMSEKMNCLDLSPNSNSDNEEEEVHVLAVDDSFVDRKVIERLLKISSCK 59 Query: 21 VTAVDS 4 VTAVDS Sbjct: 60 VTAVDS 65 >emb|CBX43984.1| putative A-type response regulator 2 [Populus x canadensis] Length = 251 Score = 70.5 bits (171), Expect = 2e-10 Identities = 40/66 (60%), Positives = 49/66 (74%), Gaps = 6/66 (9%) Frame = -2 Query: 183 MGRNAVVSNRRWMSD--SAIEFLPS----DAHVEAHVLAVDDSFVDRKVIETLLKTTSCK 22 MG N++VSNR WMS+ + ++ P+ + E HVLAVDDSFVDRKVIE LLK +SCK Sbjct: 1 MGSNSIVSNR-WMSEKMNCLDLSPNSNSDNEEEEVHVLAVDDSFVDRKVIERLLKISSCK 59 Query: 21 VTAVDS 4 VTAVDS Sbjct: 60 VTAVDS 65 >gb|ABK96781.1| unknown [Populus trichocarpa x Populus deltoides] Length = 248 Score = 70.5 bits (171), Expect = 2e-10 Identities = 40/66 (60%), Positives = 49/66 (74%), Gaps = 6/66 (9%) Frame = -2 Query: 183 MGRNAVVSNRRWMSD--SAIEFLPS----DAHVEAHVLAVDDSFVDRKVIETLLKTTSCK 22 MG N++VSNR WMS+ + ++ P+ + E HVLAVDDSFVDRKVIE LLK +SCK Sbjct: 1 MGSNSIVSNR-WMSEKMNCLDLSPNSKSDNEEEEVHVLAVDDSFVDRKVIERLLKISSCK 59 Query: 21 VTAVDS 4 VTAVDS Sbjct: 60 VTAVDS 65 >ref|XP_002520201.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223540693|gb|EEF42256.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Length = 258 Score = 67.0 bits (162), Expect = 2e-09 Identities = 40/62 (64%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = -2 Query: 183 MGRNAVVSNRRWMSDS--AIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAV 10 M RN + S RRW S+ EF D + E HVLAVDDS VDRKVIE LLK TSCKVTAV Sbjct: 1 MARNGIAS-RRWRSEKIEGFEFSSCD-NDEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 58 Query: 9 DS 4 DS Sbjct: 59 DS 60 >gb|EXB82664.1| Two-component response regulator [Morus notabilis] Length = 239 Score = 65.9 bits (159), Expect = 5e-09 Identities = 39/61 (63%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = -2 Query: 183 MGRNAVVS-NRRWMSDSAIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVD 7 M RN VS RR EF P D+ E HVLAVDDS VDRKVIE LL+ TSCKVTAVD Sbjct: 1 MARNGTVSWRRRSEKVDGFEFSPVDSE-EVHVLAVDDSLVDRKVIERLLRITSCKVTAVD 59 Query: 6 S 4 S Sbjct: 60 S 60 >ref|XP_002312769.1| type-a response regulator [Populus trichocarpa] gi|566189081|ref|XP_006378200.1| hypothetical protein POPTR_0010s04740g [Populus trichocarpa] gi|550329072|gb|ERP55997.1| hypothetical protein POPTR_0010s04740g [Populus trichocarpa] Length = 258 Score = 64.3 bits (155), Expect = 2e-08 Identities = 38/66 (57%), Positives = 43/66 (65%), Gaps = 6/66 (9%) Frame = -2 Query: 183 MGRNAVVSNRRWMSDSAIEFLPS------DAHVEAHVLAVDDSFVDRKVIETLLKTTSCK 22 M N++ SNR WMS+ F PS + HVLAVDDS VDRKVIE LLK +SCK Sbjct: 1 MSSNSIASNR-WMSEKMDGFDPSPNSNSDNEEEGVHVLAVDDSLVDRKVIERLLKISSCK 59 Query: 21 VTAVDS 4 VTAVDS Sbjct: 60 VTAVDS 65 >gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma cacao] Length = 394 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = -2 Query: 192 FMNMGRNAVVS-NRRWMSDSAIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVT 16 ++ M RN V+ RR + PSD+ E HVLAVDDS VDRKVIE LL+ +SCKVT Sbjct: 155 YLEMARNGAVTWRRRTEKIDGFDLSPSDSE-EVHVLAVDDSHVDRKVIERLLRISSCKVT 213 Query: 15 AVDS 4 AVDS Sbjct: 214 AVDS 217 >ref|XP_004297679.1| PREDICTED: two-component response regulator ARR3-like [Fragaria vesca subsp. vesca] Length = 240 Score = 63.2 bits (152), Expect = 3e-08 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -2 Query: 183 MGRNAVVSNRRWMSDSAIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 M R VVS RR +E L + EAHVLAVDDS VDRKVIE LL+ +SCKVTAVDS Sbjct: 1 MARTGVVSWRR--RSEKLEGLDLSSSEEAHVLAVDDSLVDRKVIERLLRISSCKVTAVDS 58 >emb|CBI32076.3| unnamed protein product [Vitis vinifera] Length = 221 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/56 (62%), Positives = 39/56 (69%), Gaps = 2/56 (3%) Frame = -2 Query: 165 VSNRRWMSDS--AIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 V +RR M D + P + EAHVLAVDDS VDRKVIE LLK +SCKVTAVDS Sbjct: 6 VLSRRNMPDEIGGFDLSPGHSEEEAHVLAVDDSLVDRKVIERLLKISSCKVTAVDS 61 >ref|XP_004238726.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR4-like [Solanum lycopersicum] Length = 248 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/55 (65%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -2 Query: 165 VSNRRWMSDSAIEFLP-SDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 V RRW S E LP ++A E HVLAVDDS VDR VIE LLK TSCKVT VDS Sbjct: 8 VGRRRWRSXD--ELLPLTEATHEVHVLAVDDSLVDRIVIERLLKNTSCKVTTVDS 60 >emb|CBX43983.1| putative A-type response regulator 1b [Populus x canadensis] Length = 257 Score = 61.6 bits (148), Expect = 1e-07 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 6/66 (9%) Frame = -2 Query: 183 MGRNAVVSNRRWMSDSAIEF-----LPSDAHVEA-HVLAVDDSFVDRKVIETLLKTTSCK 22 M N++ SNR WMS+ F SD E HVLAVDDS VDRKVIE LLK +SCK Sbjct: 1 MSSNSIASNR-WMSEKMDGFDLSPNSNSDNEEEGVHVLAVDDSLVDRKVIERLLKISSCK 59 Query: 21 VTAVDS 4 VTAVDS Sbjct: 60 VTAVDS 65 >emb|CBX43982.1| putative A-type response regulator 1a [Populus x canadensis] Length = 255 Score = 61.6 bits (148), Expect = 1e-07 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 6/66 (9%) Frame = -2 Query: 183 MGRNAVVSNRRWMSDSAIEF-----LPSDAHVEA-HVLAVDDSFVDRKVIETLLKTTSCK 22 M N++ SNR WMS+ F SD E HVLAVDDS VDRKVIE LLK +SCK Sbjct: 1 MSSNSIASNR-WMSEKMDGFDLSPNSNSDNEEEGVHVLAVDDSLVDRKVIERLLKISSCK 59 Query: 21 VTAVDS 4 VTAVDS Sbjct: 60 VTAVDS 65 >ref|XP_006357275.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR4-like [Solanum tuberosum] Length = 263 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/55 (65%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -2 Query: 165 VSNRRWMSDSAIEFLP-SDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 V RRW S E LP ++A E HVLAVDDS VDR VIE LLK TSCKVT VDS Sbjct: 26 VGRRRWRSXD--ELLPLTEATHEVHVLAVDDSLVDRIVIERLLKITSCKVTTVDS 78 >ref|XP_006483757.1| PREDICTED: two-component response regulator ARR4-like [Citrus sinensis] Length = 233 Score = 60.5 bits (145), Expect = 2e-07 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -2 Query: 165 VSNRRWMSDS--AIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 V++ R +SD + PSD E HVLAVDDSFVDRKVIE LL +SCKVTAVDS Sbjct: 7 VASLRLISDEIDGFDLSPSDTE-EVHVLAVDDSFVDRKVIERLLTISSCKVTAVDS 61 >gb|EMJ25075.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] Length = 232 Score = 60.1 bits (144), Expect = 3e-07 Identities = 36/61 (59%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = -2 Query: 183 MGRNAVVSNRRWMSD-SAIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVD 7 M R+ VVS RR + P ++ EAHVLAVDDS VDRKVIE LL+ +SCKVTAVD Sbjct: 1 MARSGVVSWRRRSEKLDGFDMSPMNSE-EAHVLAVDDSLVDRKVIERLLRISSCKVTAVD 59 Query: 6 S 4 S Sbjct: 60 S 60 >ref|XP_003519320.1| PREDICTED: two-component response regulator ARR4-like [Glycine max] Length = 240 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 144 SDSAIEF---LPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 +DS + F P D+H E HVLAVDDS VDRKVIE LLK ++CKVTAVDS Sbjct: 3 TDSFVSFDHVSPEDSH-EVHVLAVDDSLVDRKVIERLLKISACKVTAVDS 51 >emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera] Length = 210 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -2 Query: 120 PSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 P + EAHVLAVDDS VDRKVIE LLK +SCKVTAVDS Sbjct: 12 PGHSEEEAHVLAVDDSLVDRKVIERLLKISSCKVTAVDS 50 >dbj|BAL43556.1| type-A response regulator [Petunia x hybrida] Length = 258 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/54 (64%), Positives = 36/54 (66%) Frame = -2 Query: 165 VSNRRWMSDSAIEFLPSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 V R+W S EF P D E HVLAVDDS VDR VIE LLK TSCKVT VDS Sbjct: 8 VGRRKWRSFG--EFSPVD---EVHVLAVDDSLVDRIVIERLLKITSCKVTTVDS 56 >ref|XP_003517746.1| PREDICTED: two-component response regulator ARR4-like [Glycine max] Length = 244 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 120 PSDAHVEAHVLAVDDSFVDRKVIETLLKTTSCKVTAVDS 4 P D+H E HVLAVDDS VDRKVIE LLK ++CKVTAVDS Sbjct: 14 PEDSH-EVHVLAVDDSLVDRKVIERLLKISACKVTAVDS 51