BLASTX nr result
ID: Achyranthes23_contig00023423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00023423 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313660.2| G10 family protein [Populus trichocarpa] gi|... 105 6e-21 gb|EOY24202.1| G10 family protein [Theobroma cacao] 103 2e-20 ref|NP_001237676.1| uncharacterized protein LOC100305597 [Glycin... 103 2e-20 ref|XP_004143307.1| PREDICTED: protein BUD31 homolog 2-like [Cuc... 103 2e-20 ref|XP_003629613.1| BUD31-like protein [Medicago truncatula] gi|... 103 2e-20 ref|XP_006432787.1| hypothetical protein CICLE_v10003137mg [Citr... 102 4e-20 ref|XP_006413821.1| hypothetical protein EUTSA_v10026504mg [Eutr... 102 4e-20 ref|XP_006284682.1| hypothetical protein CARUB_v10005939mg [Caps... 102 4e-20 ref|XP_006284681.1| hypothetical protein CARUB_v10005939mg [Caps... 102 4e-20 gb|EPS69890.1| hypothetical protein M569_04873, partial [Genlise... 102 7e-20 ref|XP_004504370.1| PREDICTED: protein BUD31 homolog 2-like [Cic... 102 7e-20 gb|ESW04904.1| hypothetical protein PHAVU_011G135400g [Phaseolus... 101 9e-20 ref|XP_006397000.1| hypothetical protein EUTSA_v10028987mg [Eutr... 101 9e-20 ref|XP_004246550.1| PREDICTED: protein BUD31 homolog 2-like isof... 101 9e-20 ref|XP_004246549.1| PREDICTED: protein BUD31 homolog 2-like isof... 101 9e-20 ref|XP_003637701.1| BUD31-like protein [Medicago truncatula] gi|... 101 9e-20 emb|CBI26078.3| unnamed protein product [Vitis vinifera] 101 9e-20 ref|XP_002273849.1| PREDICTED: protein BUD31 homolog 2 [Vitis vi... 101 9e-20 ref|NP_193843.1| G10 family protein [Arabidopsis thaliana] gi|29... 101 9e-20 ref|XP_006471594.1| PREDICTED: protein BUD31 homolog 2-like isof... 100 2e-19 >ref|XP_002313660.2| G10 family protein [Populus trichocarpa] gi|550331754|gb|EEE87615.2| G10 family protein [Populus trichocarpa] Length = 145 Score = 105 bits (262), Expect = 6e-21 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKVRTNRVKYPEGWELIEPTL+EL+ KMREA+LDPHDGKRKCE LWPIFK Sbjct: 1 MPKVRTNRVKYPEGWELIEPTLRELDGKMREAELDPHDGKRKCEALWPIFK 51 >gb|EOY24202.1| G10 family protein [Theobroma cacao] Length = 145 Score = 103 bits (258), Expect = 2e-20 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 51 >ref|NP_001237676.1| uncharacterized protein LOC100305597 [Glycine max] gi|356512435|ref|XP_003524924.1| PREDICTED: protein BUD31 homolog 2-like isoform X1 [Glycine max] gi|571455651|ref|XP_006580146.1| PREDICTED: protein BUD31 homolog 2-like isoform X2 [Glycine max] gi|255626029|gb|ACU13359.1| unknown [Glycine max] gi|561034412|gb|ESW32942.1| hypothetical protein PHAVU_001G030700g [Phaseolus vulgaris] Length = 145 Score = 103 bits (258), Expect = 2e-20 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 51 >ref|XP_004143307.1| PREDICTED: protein BUD31 homolog 2-like [Cucumis sativus] gi|449511850|ref|XP_004164071.1| PREDICTED: protein BUD31 homolog 2-like [Cucumis sativus] Length = 145 Score = 103 bits (257), Expect = 2e-20 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPK++TNRVKYPEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKIKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 51 >ref|XP_003629613.1| BUD31-like protein [Medicago truncatula] gi|355523635|gb|AET04089.1| BUD31-like protein [Medicago truncatula] gi|388508458|gb|AFK42295.1| unknown [Medicago truncatula] gi|388514395|gb|AFK45259.1| unknown [Medicago truncatula] Length = 145 Score = 103 bits (257), Expect = 2e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL+ KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCETLWPIFK 51 >ref|XP_006432787.1| hypothetical protein CICLE_v10003137mg [Citrus clementina] gi|557534909|gb|ESR46027.1| hypothetical protein CICLE_v10003137mg [Citrus clementina] Length = 226 Score = 102 bits (255), Expect = 4e-20 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +2 Query: 149 KMPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 KMPKV+TNRVK PEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 81 KMPKVKTNRVKIPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 132 >ref|XP_006413821.1| hypothetical protein EUTSA_v10026504mg [Eutrema salsugineum] gi|557114991|gb|ESQ55274.1| hypothetical protein EUTSA_v10026504mg [Eutrema salsugineum] Length = 145 Score = 102 bits (255), Expect = 4e-20 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL++KMREA++D HDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAEMDTHDGKRKCETLWPIFK 51 >ref|XP_006284682.1| hypothetical protein CARUB_v10005939mg [Capsella rubella] gi|482553387|gb|EOA17580.1| hypothetical protein CARUB_v10005939mg [Capsella rubella] Length = 153 Score = 102 bits (255), Expect = 4e-20 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL++KMREA++D HDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAEMDTHDGKRKCETLWPIFK 51 >ref|XP_006284681.1| hypothetical protein CARUB_v10005939mg [Capsella rubella] gi|482553386|gb|EOA17579.1| hypothetical protein CARUB_v10005939mg [Capsella rubella] Length = 145 Score = 102 bits (255), Expect = 4e-20 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL++KMREA++D HDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAEMDTHDGKRKCETLWPIFK 51 >gb|EPS69890.1| hypothetical protein M569_04873, partial [Genlisea aurea] Length = 147 Score = 102 bits (253), Expect = 7e-20 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL EL++KMREA+LDPHD KRKCE LWPIFK Sbjct: 3 MPKVKTNRVKYPEGWELIEPTLSELQAKMREAELDPHDNKRKCEALWPIFK 53 >ref|XP_004504370.1| PREDICTED: protein BUD31 homolog 2-like [Cicer arietinum] Length = 145 Score = 102 bits (253), Expect = 7e-20 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+T+RVKYPEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTSRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 51 >gb|ESW04904.1| hypothetical protein PHAVU_011G135400g [Phaseolus vulgaris] Length = 145 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRV YPEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVTYPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 51 >ref|XP_006397000.1| hypothetical protein EUTSA_v10028987mg [Eutrema salsugineum] gi|557098017|gb|ESQ38453.1| hypothetical protein EUTSA_v10028987mg [Eutrema salsugineum] Length = 192 Score = 101 bits (252), Expect = 9e-20 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = +2 Query: 143 RSKMPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 + MPKV+TNRVKYPEGWELIEPTL+EL+++MREA++D HDGKRKCETLWPIFK Sbjct: 45 QKNMPKVKTNRVKYPEGWELIEPTLRELDAQMREAEMDSHDGKRKCETLWPIFK 98 >ref|XP_004246550.1| PREDICTED: protein BUD31 homolog 2-like isoform 2 [Solanum lycopersicum] gi|565348294|ref|XP_006341149.1| PREDICTED: protein BUD31 homolog 2-like [Solanum tuberosum] Length = 145 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL EL++KMREA+ DPHDGKRKCE LWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLSELQAKMREAENDPHDGKRKCEALWPIFK 51 >ref|XP_004246549.1| PREDICTED: protein BUD31 homolog 2-like isoform 1 [Solanum lycopersicum] Length = 152 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL EL++KMREA+ DPHDGKRKCE LWPIFK Sbjct: 8 MPKVKTNRVKYPEGWELIEPTLSELQAKMREAENDPHDGKRKCEALWPIFK 58 >ref|XP_003637701.1| BUD31-like protein [Medicago truncatula] gi|355503636|gb|AES84839.1| BUD31-like protein [Medicago truncatula] Length = 208 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+T+RVKYPEGWELIEPTL+EL+ KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTSRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCETLWPIFK 51 >emb|CBI26078.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL+ KMREA+ DPHDGKRKCE LWPIFK Sbjct: 33 MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCEALWPIFK 83 >ref|XP_002273849.1| PREDICTED: protein BUD31 homolog 2 [Vitis vinifera] Length = 145 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL+ KMREA+ DPHDGKRKCE LWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCEALWPIFK 51 >ref|NP_193843.1| G10 family protein [Arabidopsis thaliana] gi|297804046|ref|XP_002869907.1| G10 family protein [Arabidopsis lyrata subsp. lyrata] gi|15294272|gb|AAK95313.1|AF410327_1 AT4g21110/F7J7_50 [Arabidopsis thaliana] gi|2911068|emb|CAA17530.1| G10-like protein [Arabidopsis thaliana] gi|7268908|emb|CAB79111.1| G10-like protein [Arabidopsis thaliana] gi|23308281|gb|AAN18110.1| At4g21110/F7J7_50 [Arabidopsis thaliana] gi|297315743|gb|EFH46166.1| G10 family protein [Arabidopsis lyrata subsp. lyrata] gi|332659004|gb|AEE84404.1| G10 family protein [Arabidopsis thaliana] Length = 145 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVKYPEGWELIEPTL+EL++KMREA+ D HDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAETDSHDGKRKCETLWPIFK 51 >ref|XP_006471594.1| PREDICTED: protein BUD31 homolog 2-like isoform X1 [Citrus sinensis] gi|568835046|ref|XP_006471595.1| PREDICTED: protein BUD31 homolog 2-like isoform X2 [Citrus sinensis] Length = 145 Score = 100 bits (250), Expect = 2e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 152 MPKVRTNRVKYPEGWELIEPTLQELESKMREAQLDPHDGKRKCETLWPIFK 304 MPKV+TNRVK PEGWELIEPTL+EL++KMREA+ DPHDGKRKCETLWPIFK Sbjct: 1 MPKVKTNRVKIPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFK 51