BLASTX nr result
ID: Achyranthes23_contig00022998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00022998 (836 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492603.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-06 ref|XP_006420841.1| hypothetical protein CICLE_v10006919mg [Citr... 60 1e-06 ref|XP_006399423.1| hypothetical protein EUTSA_v10013686mg [Eutr... 59 2e-06 gb|EXB57865.1| hypothetical protein L484_001062 [Morus notabilis] 59 3e-06 ref|NP_568214.1| pentatricopeptide repeat-containing protein [Ar... 59 3e-06 gb|AAM64472.1| unknown [Arabidopsis thaliana] 59 3e-06 emb|CAC05471.1| putative protein [Arabidopsis thaliana] 58 5e-06 >ref|XP_006492603.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Citrus sinensis] Length = 408 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -1 Query: 677 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALEL 543 DDLKS++FR+ +++W++EGN A ++ELR I + LRKSQRYKHALE+ Sbjct: 56 DDLKSRIFRISLPKRSAINVIQRWVSEGNQATVSELRHILKELRKSQRYKHALEI 110 >ref|XP_006420841.1| hypothetical protein CICLE_v10006919mg [Citrus clementina] gi|557522714|gb|ESR34081.1| hypothetical protein CICLE_v10006919mg [Citrus clementina] Length = 377 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -1 Query: 677 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALEL 543 DDLKS++FR+ +++W++EGN A ++ELR I + LRKSQRYKHALE+ Sbjct: 35 DDLKSRIFRISLPKRSATNVIQRWVSEGNQATVSELRHILKELRKSQRYKHALEI 89 >ref|XP_006399423.1| hypothetical protein EUTSA_v10013686mg [Eutrema salsugineum] gi|557100513|gb|ESQ40876.1| hypothetical protein EUTSA_v10013686mg [Eutrema salsugineum] Length = 410 Score = 59.3 bits (142), Expect = 2e-06 Identities = 41/117 (35%), Positives = 62/117 (52%), Gaps = 10/117 (8%) Frame = -1 Query: 824 RTIITTTYTKSNLNLNSKFKAFSSSTSDALSXXXXXXXXXEFSHLTQLADDLKSQLFRL- 648 R +T +SN N++ FS S S A + F + + DDL+S++FRL Sbjct: 11 RCRLTNGVFESNFIRNAEASLFSKSYS-ADTAIGSSFVEESFDSVEK--DDLRSRIFRLR 67 Query: 647 ---------LEKWINEGNYANLTELRQICRVLRKSQRYKHALELLDPDCYWKKHAKQ 504 LEKW EGN ++TELR I R L++++RYKHALE+++ W H ++ Sbjct: 68 LPKRSATTVLEKWAGEGNQISVTELRYISRELKRTRRYKHALEIIE----WMVHHEE 120 >gb|EXB57865.1| hypothetical protein L484_001062 [Morus notabilis] Length = 203 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/55 (52%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -1 Query: 680 ADDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 546 +DD+KS++FRL L++WI+EGN +++ELRQI + LRKS RYKHALE Sbjct: 139 SDDVKSRIFRLRLPKRSATNVLQRWISEGNQISISELRQISKDLRKSHRYKHALE 193 >ref|NP_568214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75165070|sp|Q94B59.1|PP372_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g09450, mitochondrial; Flags: Precursor gi|14596093|gb|AAK68774.1| putative protein [Arabidopsis thaliana] gi|27311913|gb|AAO00922.1| putative protein [Arabidopsis thaliana] gi|332004012|gb|AED91395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 409 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 10/57 (17%) Frame = -1 Query: 677 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALELLD 537 DDLKS++FRL LEKWI EGN + ELR+I + LR+++RYKHALE+ + Sbjct: 55 DDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYKHALEVTE 111 >gb|AAM64472.1| unknown [Arabidopsis thaliana] Length = 409 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 10/57 (17%) Frame = -1 Query: 677 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALELLD 537 DDLKS++FRL LEKWI EGN + ELR+I + LR+++RYKHALE+ + Sbjct: 55 DDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYKHALEVTE 111 >emb|CAC05471.1| putative protein [Arabidopsis thaliana] Length = 402 Score = 57.8 bits (138), Expect = 5e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 10/54 (18%) Frame = -1 Query: 677 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 546 DDLKS++FRL LEKWI EGN + ELR+I + LR+++RYKHALE Sbjct: 55 DDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYKHALE 108