BLASTX nr result
ID: Achyranthes23_contig00022931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00022931 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352247.1| PREDICTED: uncharacterized protein LOC102584... 57 3e-06 ref|XP_002509966.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_006352247.1| PREDICTED: uncharacterized protein LOC102584958 [Solanum tuberosum] Length = 82 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 144 DEALKAFLSRSASGNTALSASGKASDQPKRTPVSNDEIEAILLGGCI 4 +E + F SRS ++S +GKASDQPKRTPV+ +EIE+ILLGGCI Sbjct: 39 EETPRTFFSRSPP---SMSVAGKASDQPKRTPVTQEEIESILLGGCI 82 >ref|XP_002509966.1| conserved hypothetical protein [Ricinus communis] gi|223549865|gb|EEF51353.1| conserved hypothetical protein [Ricinus communis] Length = 80 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 111 ASGNTALSASGKASDQPKRTPVSNDEIEAILLGGCI 4 +S +++ GKAS QPKRTPVSNDEIEAILLGGCI Sbjct: 45 SSSKASMTVGGKASLQPKRTPVSNDEIEAILLGGCI 80