BLASTX nr result
ID: Achyranthes23_contig00022826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00022826 (657 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW24968.1| hypothetical protein PHAVU_004G176000g [Phaseolus... 57 5e-06 >gb|ESW24968.1| hypothetical protein PHAVU_004G176000g [Phaseolus vulgaris] Length = 200 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = +1 Query: 7 GWFGG--GGEQKDVSGTSGGGEAKVLESFDSPTPMPNFEYK 123 GW GG GG +KD + TSGG E K+LESFD+P P+PNFEYK Sbjct: 161 GWIGGLFGGGKKDEASTSGGSETKILESFDAP-PVPNFEYK 200