BLASTX nr result
ID: Achyranthes23_contig00022483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00022483 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382153.1| hypothetical protein POPTR_0006s28900g [Popu... 58 1e-06 gb|EOY12541.1| Leucine-rich repeat containing protein [Theobroma... 57 3e-06 >ref|XP_006382153.1| hypothetical protein POPTR_0006s28900g [Populus trichocarpa] gi|550337308|gb|ERP59950.1| hypothetical protein POPTR_0006s28900g [Populus trichocarpa] Length = 1047 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +2 Query: 8 FFPSLQKLKINKCKNLKGWWKGEGLRLL-FPRLSKLEIWECPKLISFAPYANPD 166 FF SL++L+I C LKGWWK +GLR+L FPRLS L I++C L S + D Sbjct: 818 FFQSLKELRIFDCPRLKGWWKKKGLRMLCFPRLSSLTIYDCSNLTSMPLFPTLD 871 >gb|EOY12541.1| Leucine-rich repeat containing protein [Theobroma cacao] Length = 1024 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 7/62 (11%) Frame = +2 Query: 2 TKFFPSLQKLKINKCKNLKGWW----KGEGL---RLLFPRLSKLEIWECPKLISFAPYAN 160 T FFPSL+KL+I +C KGWW K +G + FP LSKL+I CPKL S P+ + Sbjct: 832 TSFFPSLKKLEIRECPKFKGWWWTTTKNQGSTAEQPCFPCLSKLKIRACPKLTSMPPFPS 891 Query: 161 PD 166 D Sbjct: 892 LD 893