BLASTX nr result
ID: Achyranthes23_contig00022331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00022331 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343535.1| PREDICTED: uncharacterized protein LOC102578... 38 6e-06 >ref|XP_006343535.1| PREDICTED: uncharacterized protein LOC102578284 [Solanum tuberosum] Length = 614 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -3 Query: 229 YPFVSNNFVFPIT--SLSLDIGHRRLGHPGVYVLRSLNNNNFISC 101 YP ++N FP T +L+ + H RLGHPG VL SL N I C Sbjct: 491 YP-ITNPRAFPSTFAALAPSLWHDRLGHPGAPVLNSLRKNKLIEC 534 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = -1 Query: 300 FHIQDLQTERPILRCDSKGELYHVT 226 F ++D QT RP++RC+S+G+LY +T Sbjct: 470 FPVKDFQTGRPVMRCESRGKLYPIT 494