BLASTX nr result
ID: Achyranthes23_contig00022314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00022314 (484 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC17260.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosph... 61 2e-07 >gb|EXC17260.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [Morus notabilis] Length = 607 Score = 60.8 bits (146), Expect = 2e-07 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -3 Query: 476 EKVSISKGGSIQGNSVNDSKSVPVAGAGPTAHGPEGVSDFKAMAADASVFSFG-DEDYES 300 E+VSI GS Q +++ + KS VA P+A P S+FKAMAADASVFSFG DEDYES Sbjct: 548 EQVSIGNTGSAQASTIGEPKS-NVAANVPSAEVPISESEFKAMAADASVFSFGDDEDYES 606 Query: 299 D 297 D Sbjct: 607 D 607