BLASTX nr result
ID: Achyranthes23_contig00021981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021981 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006398384.1| hypothetical protein EUTSA_v10000776mg [Eutr... 57 3e-06 >ref|XP_006398384.1| hypothetical protein EUTSA_v10000776mg [Eutrema salsugineum] gi|557099473|gb|ESQ39837.1| hypothetical protein EUTSA_v10000776mg [Eutrema salsugineum] Length = 837 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = -3 Query: 253 SGSELNMEGQDGLSGNEFDSLNGGDGDPQLPPGIKKKRYHRHTARQIQEMES 98 SGSE + +D SGNEFD N D Q PP KKKRYHRHT RQIQEME+ Sbjct: 81 SGSE---QAEDPKSGNEFDG-NELQDDEQQPPPAKKKRYHRHTNRQIQEMEA 128