BLASTX nr result
ID: Achyranthes23_contig00021944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021944 (200 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296801.1| PREDICTED: putative chromatin-remodeling com... 59 9e-07 ref|XP_006419641.1| hypothetical protein CICLE_v10004220mg [Citr... 57 3e-06 >ref|XP_004296801.1| PREDICTED: putative chromatin-remodeling complex ATPase chain-like [Fragaria vesca subsp. vesca] Length = 1063 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +3 Query: 3 EKKLAKNVTPSKRGTGRGQAEIPISSLKKRK*LTMYDYAGGSGKRRK 143 EKKLAKN+TPSKRGTGR E P SS+KKRK LTM DY +GKRR+ Sbjct: 1019 EKKLAKNMTPSKRGTGRQPTESP-SSMKKRKQLTMDDYV-STGKRRR 1063 >ref|XP_006419641.1| hypothetical protein CICLE_v10004220mg [Citrus clementina] gi|568871930|ref|XP_006489131.1| PREDICTED: putative chromatin-remodeling complex ATPase chain-like [Citrus sinensis] gi|557521514|gb|ESR32881.1| hypothetical protein CICLE_v10004220mg [Citrus clementina] Length = 1067 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/47 (72%), Positives = 36/47 (76%) Frame = +3 Query: 3 EKKLAKNVTPSKRGTGRGQAEIPISSLKKRK*LTMYDYAGGSGKRRK 143 EKKLAKN+TPSKRG GR E P SSLKKRK L+M DY SGKRRK Sbjct: 1023 EKKLAKNMTPSKRGGGRQPNESP-SSLKKRKQLSMDDYV-SSGKRRK 1067