BLASTX nr result
ID: Achyranthes23_contig00021713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021713 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW68339.1| dehydration-responsive element binding protein [A... 57 3e-06 gb|ACS35626.1| ethylene signal transcription factor [Morus alba] 57 3e-06 >gb|AEW68339.1| dehydration-responsive element binding protein [Atriplex canescens] Length = 387 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +1 Query: 85 MCGGAVISDCLPHARPSLLTSDSLWPDDLNSAKKSFSGYCTPLRSSIINVDDD 243 MCGGAVISD +P R L D LWP DL S KK SGY PLRS + V D+ Sbjct: 1 MCGGAVISDYIPAGRSHRLNPDYLWP-DLKSFKKGSSGYSKPLRSETLKVVDE 52 >gb|ACS35626.1| ethylene signal transcription factor [Morus alba] Length = 388 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +1 Query: 85 MCGGAVISDCLPHARPSLLTSDSLWPDDLNSAKKSFSG--YCTPLRSSIINVDDD 243 MCGGA+ISD + R + LT+D LWPD KKS SG +C P+RS I+++DDD Sbjct: 1 MCGGAIISDFISTPRSTRLTADYLWPD----LKKSGSGKRFCKPVRSVIVDIDDD 51