BLASTX nr result
ID: Achyranthes23_contig00021632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021632 (276 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citr... 57 2e-06 gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] 55 7e-06 gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus do... 55 1e-05 gb|AEN94093.1| cinnamyl alcohol dehydrogenase [Pyrus pyrifolia] 55 1e-05 gb|ABV44810.1| cinnamyl alcohol dehydrogenase 1 [Eriobotrya japo... 55 1e-05 >ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citrus clementina] gi|568832844|ref|XP_006470636.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis] gi|557548757|gb|ESR59386.1| hypothetical protein CICLE_v10015912mg [Citrus clementina] Length = 327 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = -3 Query: 220 FPTYELPKLFRLAVDDDDNPLKASHYEVSKKRAQSLGIDTFIPLRTSLKETIESLVEKGF 41 +PT+ELP+ DD P + Y+VSK++A++LGI+ FIPL SLKETIESL EKGF Sbjct: 272 YPTFELPEKCA-----DDKPYVPT-YQVSKEKAKNLGIE-FIPLEVSLKETIESLKEKGF 324 Query: 40 I 38 + Sbjct: 325 V 325 >gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] Length = 325 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/62 (51%), Positives = 43/62 (69%) Frame = -3 Query: 220 FPTYELPKLFRLAVDDDDNPLKASHYEVSKKRAQSLGIDTFIPLRTSLKETIESLVEKGF 41 +PT +LP DD P + Y+VSK++A+SLG++ FIPL SLKET+ESL EKGF Sbjct: 270 YPTLQLPDKCA-----DDKPFVPT-YQVSKEKAKSLGVE-FIPLDVSLKETVESLKEKGF 322 Query: 40 IS 35 +S Sbjct: 323 VS 324 >gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus domestica] Length = 325 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/62 (50%), Positives = 44/62 (70%) Frame = -3 Query: 220 FPTYELPKLFRLAVDDDDNPLKASHYEVSKKRAQSLGIDTFIPLRTSLKETIESLVEKGF 41 +PT +LP+ DD P + Y+VSK++A+SLG++ FIPL SLKET+ESL EKGF Sbjct: 270 YPTLQLPEKCA-----DDKPFVPT-YQVSKEKAKSLGVE-FIPLDVSLKETVESLKEKGF 322 Query: 40 IS 35 ++ Sbjct: 323 VN 324 >gb|AEN94093.1| cinnamyl alcohol dehydrogenase [Pyrus pyrifolia] Length = 143 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/62 (50%), Positives = 44/62 (70%) Frame = -3 Query: 220 FPTYELPKLFRLAVDDDDNPLKASHYEVSKKRAQSLGIDTFIPLRTSLKETIESLVEKGF 41 +PT +LP+ DD P + Y+VSK++A+SLG++ FIPL SLKET+ESL EKGF Sbjct: 88 YPTLQLPEKCA-----DDKPFVPT-YQVSKEKAKSLGVE-FIPLDVSLKETVESLKEKGF 140 Query: 40 IS 35 ++ Sbjct: 141 VN 142 >gb|ABV44810.1| cinnamyl alcohol dehydrogenase 1 [Eriobotrya japonica] Length = 305 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/62 (50%), Positives = 44/62 (70%) Frame = -3 Query: 220 FPTYELPKLFRLAVDDDDNPLKASHYEVSKKRAQSLGIDTFIPLRTSLKETIESLVEKGF 41 +PT +LP+ DD P + Y+VSK++A++LG++ FIPL SLKET+ESL EKGF Sbjct: 250 YPTLQLPEKCA-----DDKPFVPT-YQVSKEKAKNLGVE-FIPLDVSLKETVESLKEKGF 302 Query: 40 IS 35 +S Sbjct: 303 VS 304