BLASTX nr result
ID: Achyranthes23_contig00021614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021614 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633433.1| PREDICTED: BTB/POZ domain-containing protein... 129 4e-28 emb|CBI25397.3| unnamed protein product [Vitis vinifera] 129 4e-28 gb|EMJ22286.1| hypothetical protein PRUPE_ppa016920mg [Prunus pe... 123 2e-26 gb|EOY20009.1| BTB/POZ domain-containing protein, putative isofo... 122 5e-26 gb|EOY20008.1| BTB/POZ domain-containing protein, putative isofo... 122 5e-26 gb|EOY20007.1| BTB/POZ domain-containing protein, putative isofo... 122 5e-26 ref|XP_003538495.2| PREDICTED: BTB/POZ domain-containing protein... 119 5e-25 ref|XP_002878074.1| hypothetical protein ARALYDRAFT_348708 [Arab... 117 1e-24 ref|XP_006291636.1| hypothetical protein CARUB_v10017788mg [Caps... 117 2e-24 ref|XP_002520826.1| protein binding protein, putative [Ricinus c... 116 4e-24 ref|XP_003601025.1| Speckle-type POZ protein-like protein [Medic... 115 5e-24 ref|XP_003601024.1| Speckle-type POZ protein-like protein [Medic... 115 5e-24 ref|XP_006403007.1| hypothetical protein EUTSA_v10006174mg [Eutr... 115 6e-24 ref|XP_006376030.1| hypothetical protein POPTR_0013s08150g [Popu... 115 8e-24 gb|EOY20005.1| BTB/POZ domain-containing protein, putative isofo... 115 8e-24 gb|EOY20004.1| BTB/POZ domain-containing protein, putative isofo... 115 8e-24 gb|EOY20003.1| BTB/POZ domain-containing-like protein isoform 1 ... 115 8e-24 ref|XP_002328956.1| predicted protein [Populus trichocarpa] 115 8e-24 ref|XP_004500541.1| PREDICTED: BTB/POZ domain-containing protein... 114 1e-23 ref|NP_191182.1| BTB/POZ domain-containing protein [Arabidopsis ... 114 1e-23 >ref|XP_003633433.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Vitis vinifera] Length = 270 Score = 129 bits (324), Expect = 4e-28 Identities = 63/80 (78%), Positives = 71/80 (88%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G+NGP + AHRALLA++SEIFKNMLDSD CK AP+ ITLPEL+HEEL+SLL+FLY GSL Sbjct: 105 GHNGPSLFAHRALLAARSEIFKNMLDSDGCKAAPSNTITLPELNHEELDSLLEFLYSGSL 164 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P D VEKHVYSLSLAADKYE Sbjct: 165 PADKVEKHVYSLSLAADKYE 184 >emb|CBI25397.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 129 bits (324), Expect = 4e-28 Identities = 63/80 (78%), Positives = 71/80 (88%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G+NGP + AHRALLA++SEIFKNMLDSD CK AP+ ITLPEL+HEEL+SLL+FLY GSL Sbjct: 116 GHNGPSLFAHRALLAARSEIFKNMLDSDGCKAAPSNTITLPELNHEELDSLLEFLYSGSL 175 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P D VEKHVYSLSLAADKYE Sbjct: 176 PADKVEKHVYSLSLAADKYE 195 >gb|EMJ22286.1| hypothetical protein PRUPE_ppa016920mg [Prunus persica] Length = 289 Score = 123 bits (309), Expect = 2e-26 Identities = 59/79 (74%), Positives = 67/79 (84%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G+NGPPIPAHRALLA +SEIF NMLDSD CK PN+A+TLPEL+HEELESLL+FLY G L Sbjct: 125 GDNGPPIPAHRALLAIRSEIFNNMLDSDGCKAPPNDAVTLPELNHEELESLLEFLYNGDL 184 Query: 181 PNDVVEKHVYSLSLAADKY 237 + + KHVYSL LAADKY Sbjct: 185 HEEKMNKHVYSLFLAADKY 203 >gb|EOY20009.1| BTB/POZ domain-containing protein, putative isoform 3 [Theobroma cacao] Length = 274 Score = 122 bits (306), Expect = 5e-26 Identities = 59/80 (73%), Positives = 70/80 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 GN+GP IPAHRALLA++SEIF+NMLDSD CK P++ ITLPEL+ EELESLL+FLY G+L Sbjct: 108 GNHGPCIPAHRALLAARSEIFRNMLDSDGCKAPPSDTITLPELNTEELESLLEFLYSGNL 167 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P D +EKHVYSL +AADKYE Sbjct: 168 PFDKLEKHVYSLFVAADKYE 187 >gb|EOY20008.1| BTB/POZ domain-containing protein, putative isoform 2 [Theobroma cacao] Length = 290 Score = 122 bits (306), Expect = 5e-26 Identities = 59/80 (73%), Positives = 70/80 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 GN+GP IPAHRALLA++SEIF+NMLDSD CK P++ ITLPEL+ EELESLL+FLY G+L Sbjct: 124 GNHGPCIPAHRALLAARSEIFRNMLDSDGCKAPPSDTITLPELNTEELESLLEFLYSGNL 183 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P D +EKHVYSL +AADKYE Sbjct: 184 PFDKLEKHVYSLFVAADKYE 203 >gb|EOY20007.1| BTB/POZ domain-containing protein, putative isoform 1 [Theobroma cacao] Length = 297 Score = 122 bits (306), Expect = 5e-26 Identities = 59/80 (73%), Positives = 70/80 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 GN+GP IPAHRALLA++SEIF+NMLDSD CK P++ ITLPEL+ EELESLL+FLY G+L Sbjct: 131 GNHGPCIPAHRALLAARSEIFRNMLDSDGCKAPPSDTITLPELNTEELESLLEFLYSGNL 190 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P D +EKHVYSL +AADKYE Sbjct: 191 PFDKLEKHVYSLFVAADKYE 210 >ref|XP_003538495.2| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Glycine max] Length = 269 Score = 119 bits (297), Expect = 5e-25 Identities = 54/79 (68%), Positives = 70/79 (88%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G NGPPIPAH+++LA++SEIFKNML+ D+CK AP+ AIT+P+L+HEELESLL+FLY G+L Sbjct: 109 GRNGPPIPAHKSVLAARSEIFKNMLECDECKAAPSNAITIPDLNHEELESLLEFLYSGTL 168 Query: 181 PNDVVEKHVYSLSLAADKY 237 + +EKHVY+LS AADKY Sbjct: 169 NVEKLEKHVYALSQAADKY 187 >ref|XP_002878074.1| hypothetical protein ARALYDRAFT_348708 [Arabidopsis lyrata subsp. lyrata] gi|297323912|gb|EFH54333.1| hypothetical protein ARALYDRAFT_348708 [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 117 bits (294), Expect = 1e-24 Identities = 56/79 (70%), Positives = 69/79 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G++GPPIPAHRALLASKSEIFKN+LDSD CK AP AITL EL+ E+L++LL+FLY G+L Sbjct: 109 GDDGPPIPAHRALLASKSEIFKNILDSDGCKTAPEYAITLQELNSEQLQALLEFLYTGTL 168 Query: 181 PNDVVEKHVYSLSLAADKY 237 +D +EKH+Y+L LAADKY Sbjct: 169 ASDKLEKHIYALFLAADKY 187 >ref|XP_006291636.1| hypothetical protein CARUB_v10017788mg [Capsella rubella] gi|482560343|gb|EOA24534.1| hypothetical protein CARUB_v10017788mg [Capsella rubella] Length = 281 Score = 117 bits (292), Expect = 2e-24 Identities = 56/79 (70%), Positives = 69/79 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G++GPPIPAHRALLASKSEIFKN+LDSD CK AP AITL EL+ E+L++LL+FLY G+L Sbjct: 117 GDDGPPIPAHRALLASKSEIFKNILDSDGCKTAPEYAITLQELNSEQLQALLEFLYTGTL 176 Query: 181 PNDVVEKHVYSLSLAADKY 237 +D +EKHVY+L +AADKY Sbjct: 177 ASDKLEKHVYALFVAADKY 195 >ref|XP_002520826.1| protein binding protein, putative [Ricinus communis] gi|223539957|gb|EEF41535.1| protein binding protein, putative [Ricinus communis] Length = 267 Score = 116 bits (290), Expect = 4e-24 Identities = 55/80 (68%), Positives = 67/80 (83%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 GN GP + AHRALLA++SEIF+NMLDSD CK ++ ITL EL+HEELE+LL+FLY GSL Sbjct: 99 GNGGPSVSAHRALLAARSEIFRNMLDSDACKAPADDTITLAELNHEELETLLEFLYSGSL 158 Query: 181 PNDVVEKHVYSLSLAADKYE 240 + VEKH+YSL+LAADKYE Sbjct: 159 ATEKVEKHIYSLTLAADKYE 178 >ref|XP_003601025.1| Speckle-type POZ protein-like protein [Medicago truncatula] gi|355490073|gb|AES71276.1| Speckle-type POZ protein-like protein [Medicago truncatula] Length = 236 Score = 115 bits (289), Expect = 5e-24 Identities = 54/80 (67%), Positives = 70/80 (87%), Gaps = 1/80 (1%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPN-EAITLPELDHEELESLLKFLYCGS 177 GN+GPPIPAH+++LA++SEIFKNML+ D+CK AP IT+P+L+HEELESLL+FLY G+ Sbjct: 70 GNHGPPIPAHKSVLAARSEIFKNMLEIDECKAAPTCNTITIPDLNHEELESLLEFLYSGT 129 Query: 178 LPNDVVEKHVYSLSLAADKY 237 LP + +EKHVY+LS AADKY Sbjct: 130 LPLEKLEKHVYALSQAADKY 149 >ref|XP_003601024.1| Speckle-type POZ protein-like protein [Medicago truncatula] gi|355490072|gb|AES71275.1| Speckle-type POZ protein-like protein [Medicago truncatula] Length = 273 Score = 115 bits (289), Expect = 5e-24 Identities = 54/80 (67%), Positives = 70/80 (87%), Gaps = 1/80 (1%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPN-EAITLPELDHEELESLLKFLYCGS 177 GN+GPPIPAH+++LA++SEIFKNML+ D+CK AP IT+P+L+HEELESLL+FLY G+ Sbjct: 107 GNHGPPIPAHKSVLAARSEIFKNMLEIDECKAAPTCNTITIPDLNHEELESLLEFLYSGT 166 Query: 178 LPNDVVEKHVYSLSLAADKY 237 LP + +EKHVY+LS AADKY Sbjct: 167 LPLEKLEKHVYALSQAADKY 186 >ref|XP_006403007.1| hypothetical protein EUTSA_v10006174mg [Eutrema salsugineum] gi|557104106|gb|ESQ44460.1| hypothetical protein EUTSA_v10006174mg [Eutrema salsugineum] Length = 265 Score = 115 bits (288), Expect = 6e-24 Identities = 56/77 (72%), Positives = 67/77 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G+ GPPIPAHRALLASKSEIFKN+LDSD+CK AP AITL EL+ EEL++LL+FLY G+L Sbjct: 117 GDEGPPIPAHRALLASKSEIFKNILDSDECKTAPEYAITLQELNSEELQALLEFLYTGTL 176 Query: 181 PNDVVEKHVYSLSLAAD 231 +D +EKHVY+L LAAD Sbjct: 177 ASDKLEKHVYALFLAAD 193 >ref|XP_006376030.1| hypothetical protein POPTR_0013s08150g [Populus trichocarpa] gi|550325253|gb|ERP53827.1| hypothetical protein POPTR_0013s08150g [Populus trichocarpa] Length = 273 Score = 115 bits (287), Expect = 8e-24 Identities = 55/80 (68%), Positives = 69/80 (86%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 GN+GP I AHRALLA++SEIFKNMLDSD K ++ I LPEL+H+ELESLL+FLY G+L Sbjct: 107 GNDGPSISAHRALLAARSEIFKNMLDSDAYKAPASDTIMLPELNHQELESLLEFLYSGNL 166 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P++ +EKHVYSL+LAADKY+ Sbjct: 167 PSEKLEKHVYSLTLAADKYD 186 >gb|EOY20005.1| BTB/POZ domain-containing protein, putative isoform 3 [Theobroma cacao] Length = 301 Score = 115 bits (287), Expect = 8e-24 Identities = 58/81 (71%), Positives = 69/81 (85%), Gaps = 2/81 (2%) Frame = +1 Query: 4 NNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEA--ITLPELDHEELESLLKFLYCGS 177 NNGP IPAH+ALLA++SEIFKNMLDSD CK P++ ITL EL++EELESLL+FLY G+ Sbjct: 140 NNGPCIPAHKALLAARSEIFKNMLDSDGCKAPPSDTDTITLSELNNEELESLLEFLYTGN 199 Query: 178 LPNDVVEKHVYSLSLAADKYE 240 LP D +EKHVYSL +AADKYE Sbjct: 200 LPLDKLEKHVYSLYVAADKYE 220 >gb|EOY20004.1| BTB/POZ domain-containing protein, putative isoform 2 [Theobroma cacao] Length = 269 Score = 115 bits (287), Expect = 8e-24 Identities = 58/81 (71%), Positives = 69/81 (85%), Gaps = 2/81 (2%) Frame = +1 Query: 4 NNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEA--ITLPELDHEELESLLKFLYCGS 177 NNGP IPAH+ALLA++SEIFKNMLDSD CK P++ ITL EL++EELESLL+FLY G+ Sbjct: 108 NNGPCIPAHKALLAARSEIFKNMLDSDGCKAPPSDTDTITLSELNNEELESLLEFLYTGN 167 Query: 178 LPNDVVEKHVYSLSLAADKYE 240 LP D +EKHVYSL +AADKYE Sbjct: 168 LPLDKLEKHVYSLYVAADKYE 188 >gb|EOY20003.1| BTB/POZ domain-containing-like protein isoform 1 [Theobroma cacao] Length = 355 Score = 115 bits (287), Expect = 8e-24 Identities = 58/81 (71%), Positives = 69/81 (85%), Gaps = 2/81 (2%) Frame = +1 Query: 4 NNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEA--ITLPELDHEELESLLKFLYCGS 177 NNGP IPAH+ALLA++SEIFKNMLDSD CK P++ ITL EL++EELESLL+FLY G+ Sbjct: 194 NNGPCIPAHKALLAARSEIFKNMLDSDGCKAPPSDTDTITLSELNNEELESLLEFLYTGN 253 Query: 178 LPNDVVEKHVYSLSLAADKYE 240 LP D +EKHVYSL +AADKYE Sbjct: 254 LPLDKLEKHVYSLYVAADKYE 274 >ref|XP_002328956.1| predicted protein [Populus trichocarpa] Length = 189 Score = 115 bits (287), Expect = 8e-24 Identities = 55/80 (68%), Positives = 69/80 (86%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 GN+GP I AHRALLA++SEIFKNMLDSD K ++ I LPEL+H+ELESLL+FLY G+L Sbjct: 30 GNDGPSISAHRALLAARSEIFKNMLDSDAYKAPASDTIMLPELNHQELESLLEFLYSGNL 89 Query: 181 PNDVVEKHVYSLSLAADKYE 240 P++ +EKHVYSL+LAADKY+ Sbjct: 90 PSEKLEKHVYSLTLAADKYD 109 >ref|XP_004500541.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Cicer arietinum] Length = 267 Score = 114 bits (286), Expect = 1e-23 Identities = 51/78 (65%), Positives = 69/78 (88%) Frame = +1 Query: 4 NNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSLP 183 N+GPPIPAH+++LA++SEIFKNML+ D+CK P+ IT+P+L+HEELESLL+FLY G+L Sbjct: 108 NHGPPIPAHKSVLAARSEIFKNMLECDECKAPPSNNITIPDLNHEELESLLEFLYSGTLT 167 Query: 184 NDVVEKHVYSLSLAADKY 237 ++ +EKHVY+LS AADKY Sbjct: 168 SEKLEKHVYALSQAADKY 185 >ref|NP_191182.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75264422|sp|Q9LYL9.1|Y3623_ARATH RecName: Full=BTB/POZ domain-containing protein At3g56230 gi|7572921|emb|CAB87422.1| putative protein [Arabidopsis thaliana] gi|45825155|gb|AAS77485.1| At3g56230 [Arabidopsis thaliana] gi|51970740|dbj|BAD44062.1| putative protein [Arabidopsis thaliana] gi|332645978|gb|AEE79499.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Length = 282 Score = 114 bits (286), Expect = 1e-23 Identities = 55/79 (69%), Positives = 69/79 (87%) Frame = +1 Query: 1 GNNGPPIPAHRALLASKSEIFKNMLDSDDCKEAPNEAITLPELDHEELESLLKFLYCGSL 180 G++GPPIPAHRALLASKSEIFKN+LDSD CK AP AITL EL+ E+L++LL+FLY G+L Sbjct: 118 GDDGPPIPAHRALLASKSEIFKNILDSDGCKTAPEYAITLQELNSEQLQALLEFLYTGTL 177 Query: 181 PNDVVEKHVYSLSLAADKY 237 +D +EK+VY+L +AADKY Sbjct: 178 ASDKLEKNVYALFIAADKY 196