BLASTX nr result
ID: Achyranthes23_contig00021539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021539 (529 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532845.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >ref|XP_002532845.1| conserved hypothetical protein [Ricinus communis] gi|223527412|gb|EEF29552.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 62.4 bits (150), Expect = 6e-08 Identities = 39/78 (50%), Positives = 48/78 (61%), Gaps = 3/78 (3%) Frame = +3 Query: 270 SIDALAMAGVDYQESGIDFEEMEFRDMESTPLYLIAETESDKKQPE---QQNKVATKFDR 440 SI+ALAMAGVD E GI+ EE E R+ME TP YL+AE E KK+ E + N K Sbjct: 3 SIEALAMAGVDCVECGINLEETERRNMEHTPQYLLAEEEPGKKEGEIGDKDNNNNNKLMA 62 Query: 441 ENLQVNFEIQPRKKAGAS 494 EN QV +++ KA AS Sbjct: 63 ENWQVKTKMEACVKAVAS 80