BLASTX nr result
ID: Achyranthes23_contig00021414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021414 (226 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343535.1| PREDICTED: uncharacterized protein LOC102578... 65 1e-08 ref|XP_006582651.1| PREDICTED: uncharacterized mitochondrial pro... 60 3e-07 >ref|XP_006343535.1| PREDICTED: uncharacterized protein LOC102578284 [Solanum tuberosum] Length = 614 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = -3 Query: 188 CNSRGDLYPLTSTAQNYSHSTFASISPSVWHHRLVHPGLPVFNFLKSNNIISCNK 24 C SRG LYP+T+ STFA+++PS+WH RL HPG PV N L+ N +I CN+ Sbjct: 484 CESRGKLYPITNPRA--FPSTFAALAPSLWHDRLGHPGAPVLNSLRKNKLIECNQ 536 >ref|XP_006582651.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Glycine max] Length = 317 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -3 Query: 188 CNSRGDLYPLT-STAQNYSHSTFASISPSVWHHRLVHPGLPVFNFLKSNNIISC 30 C S G LYP+T ST S STFAS++PS+WH RL HPG+ + + L+ N I C Sbjct: 24 CESWGMLYPITESTTPATSSSTFASLAPSLWHERLGHPGVSILHSLRKNKFIEC 77