BLASTX nr result
ID: Achyranthes23_contig00021398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021398 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488615.1| PREDICTED: organic cation/carnitine transpor... 63 4e-08 ref|XP_006425192.1| hypothetical protein CICLE_v10028224mg [Citr... 63 4e-08 ref|XP_006425191.1| hypothetical protein CICLE_v10028224mg [Citr... 63 4e-08 ref|XP_006425190.1| hypothetical protein CICLE_v10028224mg [Citr... 63 4e-08 ref|XP_006585686.1| PREDICTED: organic cation/carnitine transpor... 62 1e-07 ref|XP_006582967.1| PREDICTED: organic cation/carnitine transpor... 62 1e-07 gb|ESW07871.1| hypothetical protein PHAVU_010G165500g [Phaseolus... 62 1e-07 ref|XP_006299899.1| hypothetical protein CARUB_v10016107mg [Caps... 61 1e-07 gb|EMJ16471.1| hypothetical protein PRUPE_ppa004702mg [Prunus pe... 61 1e-07 ref|NP_187911.1| nicotinate transporter [Arabidopsis thaliana] g... 61 1e-07 dbj|BAB02515.1| transporter-like protein [Arabidopsis thaliana] 61 1e-07 ref|XP_002882803.1| hypothetical protein ARALYDRAFT_318077 [Arab... 61 1e-07 gb|EXB26127.1| Organic cation/carnitine transporter 7 [Morus not... 61 2e-07 ref|XP_006380840.1| transporter-related family protein [Populus ... 61 2e-07 ref|XP_006380839.1| hypothetical protein POPTR_0007s15120g [Popu... 61 2e-07 ref|XP_006380838.1| hypothetical protein POPTR_0007s15120g [Popu... 61 2e-07 ref|XP_002310344.2| hypothetical protein POPTR_0007s15120g [Popu... 61 2e-07 ref|XP_006380837.1| hypothetical protein POPTR_0007s15120g [Popu... 61 2e-07 ref|XP_006380836.1| hypothetical protein POPTR_0007s15120g [Popu... 61 2e-07 gb|EOY26210.1| Major facilitator superfamily protein isoform 6 [... 61 2e-07 >ref|XP_006488615.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus sinensis] Length = 514 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS N+ES+ITSVVFAGML+GAYSWGIVSD FGRR Sbjct: 61 LSPNQESLITSVVFAGMLVGAYSWGIVSDNFGRR 94 >ref|XP_006425192.1| hypothetical protein CICLE_v10028224mg [Citrus clementina] gi|557527126|gb|ESR38432.1| hypothetical protein CICLE_v10028224mg [Citrus clementina] Length = 514 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS N+ES+ITSVVFAGML+GAYSWGIVSD FGRR Sbjct: 61 LSPNQESLITSVVFAGMLVGAYSWGIVSDNFGRR 94 >ref|XP_006425191.1| hypothetical protein CICLE_v10028224mg [Citrus clementina] gi|557527125|gb|ESR38431.1| hypothetical protein CICLE_v10028224mg [Citrus clementina] Length = 314 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS N+ES+ITSVVFAGML+GAYSWGIVSD FGRR Sbjct: 61 LSPNQESLITSVVFAGMLVGAYSWGIVSDNFGRR 94 >ref|XP_006425190.1| hypothetical protein CICLE_v10028224mg [Citrus clementina] gi|557527124|gb|ESR38430.1| hypothetical protein CICLE_v10028224mg [Citrus clementina] Length = 377 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS N+ES+ITSVVFAGML+GAYSWGIVSD FGRR Sbjct: 61 LSPNQESLITSVVFAGMLVGAYSWGIVSDNFGRR 94 >ref|XP_006585686.1| PREDICTED: organic cation/carnitine transporter 7-like [Glycine max] Length = 487 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+++ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 58 LSAHEESLITSVVFAGMLIGAYSWGIVSDKHGRR 91 >ref|XP_006582967.1| PREDICTED: organic cation/carnitine transporter 7-like isoform X1 [Glycine max] Length = 487 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+++ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 58 LSAHEESLITSVVFAGMLIGAYSWGIVSDKHGRR 91 >gb|ESW07871.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris] Length = 487 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+++ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 58 LSAHEESLITSVVFAGMLIGAYSWGIVSDKHGRR 91 >ref|XP_006299899.1| hypothetical protein CARUB_v10016107mg [Capsella rubella] gi|482568608|gb|EOA32797.1| hypothetical protein CARUB_v10016107mg [Capsella rubella] Length = 500 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+ +ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 57 LSAREESLITSVVFAGMLIGAYSWGIVSDKHGRR 90 >gb|EMJ16471.1| hypothetical protein PRUPE_ppa004702mg [Prunus persica] Length = 495 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LSS +ES ITSVVFAGML+GAYSWGIVSDK GRR Sbjct: 57 LSSQQESFITSVVFAGMLVGAYSWGIVSDKHGRR 90 >ref|NP_187911.1| nicotinate transporter [Arabidopsis thaliana] gi|75305942|sp|Q940M4.1|OCT7_ARATH RecName: Full=Organic cation/carnitine transporter 7; Short=AtOCT7 gi|15809988|gb|AAL06921.1| AT3g13050/MGH6_16 [Arabidopsis thaliana] gi|28416475|gb|AAO42768.1| At3g13050/MGH6_16 [Arabidopsis thaliana] gi|332641762|gb|AEE75283.1| nicotinate transporter [Arabidopsis thaliana] Length = 500 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+ +ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 57 LSARQESLITSVVFAGMLIGAYSWGIVSDKHGRR 90 >dbj|BAB02515.1| transporter-like protein [Arabidopsis thaliana] Length = 470 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+ +ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 57 LSARQESLITSVVFAGMLIGAYSWGIVSDKHGRR 90 >ref|XP_002882803.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. lyrata] gi|297328643|gb|EFH59062.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. lyrata] Length = 500 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LS+ +ES+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 57 LSAREESLITSVVFAGMLIGAYSWGIVSDKHGRR 90 >gb|EXB26127.1| Organic cation/carnitine transporter 7 [Morus notabilis] Length = 474 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 +SS+++S+ITSVVFAGMLIGAYSWGIVSDK GRR Sbjct: 59 ISSHQQSLITSVVFAGMLIGAYSWGIVSDKHGRR 92 >ref|XP_006380840.1| transporter-related family protein [Populus trichocarpa] gi|550334937|gb|ERP58637.1| transporter-related family protein [Populus trichocarpa] Length = 506 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 L+S +ES+ITSVVFAGML+GAYSWG+VSD++GRR Sbjct: 57 LTSQQESLITSVVFAGMLVGAYSWGVVSDRYGRR 90 >ref|XP_006380839.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] gi|550334936|gb|ERP58636.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] Length = 490 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 L+S +ES+ITSVVFAGML+GAYSWG+VSD++GRR Sbjct: 41 LTSQQESLITSVVFAGMLVGAYSWGVVSDRYGRR 74 >ref|XP_006380838.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] gi|550334935|gb|ERP58635.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] Length = 529 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 L+S +ES+ITSVVFAGML+GAYSWG+VSD++GRR Sbjct: 80 LTSQQESLITSVVFAGMLVGAYSWGVVSDRYGRR 113 >ref|XP_002310344.2| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] gi|550334934|gb|EEE90794.2| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] Length = 601 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 L+S +ES+ITSVVFAGML+GAYSWG+VSD++GRR Sbjct: 152 LTSQQESLITSVVFAGMLVGAYSWGVVSDRYGRR 185 >ref|XP_006380837.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] gi|550334933|gb|ERP58634.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] Length = 456 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 L+S +ES+ITSVVFAGML+GAYSWG+VSD++GRR Sbjct: 152 LTSQQESLITSVVFAGMLVGAYSWGVVSDRYGRR 185 >ref|XP_006380836.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] gi|550334932|gb|ERP58633.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa] Length = 518 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 L+S +ES+ITSVVFAGML+GAYSWG+VSD++GRR Sbjct: 152 LTSQQESLITSVVFAGMLVGAYSWGVVSDRYGRR 185 >gb|EOY26210.1| Major facilitator superfamily protein isoform 6 [Theobroma cacao] Length = 360 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 456 LSSNKESMITSVVFAGMLIGAYSWGIVSDKFGRR 355 LSS++ES+ITSVVF GMLIGAYSWG+VSDK GRR Sbjct: 58 LSSHEESLITSVVFVGMLIGAYSWGVVSDKHGRR 91