BLASTX nr result
ID: Achyranthes23_contig00021062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00021062 (558 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553006.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 75 8e-12 ref|XP_003530531.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 75 8e-12 gb|ACU23162.1| unknown [Glycine max] 75 8e-12 ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus... 74 3e-11 ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloro... 73 4e-11 gb|EMJ10674.1| hypothetical protein PRUPE_ppa010021mg [Prunus pe... 73 4e-11 gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] 72 7e-11 gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus... 72 7e-11 ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] g... 72 7e-11 ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus... 72 7e-11 ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloro... 72 9e-11 gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilop... 72 9e-11 gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticu... 72 9e-11 ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloro... 72 9e-11 dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgar... 72 9e-11 gb|EPS71409.1| hypothetical protein M569_03350, partial [Genlise... 72 1e-10 ref|XP_004160907.1| PREDICTED: 50S ribosomal protein L19, chloro... 72 1e-10 ref|XP_004139446.1| PREDICTED: 50S ribosomal protein L19, chloro... 72 1e-10 ref|XP_003563681.1| PREDICTED: 50S ribosomal protein L19, chloro... 72 1e-10 ref|XP_004975505.1| PREDICTED: 50S ribosomal protein L19, chloro... 71 2e-10 >ref|XP_003553006.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Glycine max] Length = 236 Score = 75.5 bits (184), Expect = 8e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLK 119 +E+L PLYSPNIKEIKVLDKK+VRRAKLYYLRERMNPLK Sbjct: 197 IESLFPLYSPNIKEIKVLDKKRVRRAKLYYLRERMNPLK 235 >ref|XP_003530531.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Glycine max] Length = 231 Score = 75.5 bits (184), Expect = 8e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLK 119 +E+L PLYSPNIKEIKVLDKK+VRRAKLYYLRERMNPLK Sbjct: 192 IESLFPLYSPNIKEIKVLDKKRVRRAKLYYLRERMNPLK 230 >gb|ACU23162.1| unknown [Glycine max] Length = 109 Score = 75.5 bits (184), Expect = 8e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLK 119 +E+L PLYSPNIKEIKVLDKK+VRRAKLYYLRERMNPLK Sbjct: 70 IESLFPLYSPNIKEIKVLDKKRVRRAKLYYLRERMNPLK 108 >ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223540999|gb|EEF42557.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 248 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE+L PLYSPNIKEIKVLDKKKVRRAKLYYLR++MN LKK Sbjct: 208 VESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 247 >ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 242 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE+L PLYSPNIKEIK+LDKKKVRRAKLYYLR++MN LKK Sbjct: 202 VESLFPLYSPNIKEIKILDKKKVRRAKLYYLRDKMNALKK 241 >gb|EMJ10674.1| hypothetical protein PRUPE_ppa010021mg [Prunus persica] Length = 267 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE+LLPLYSPNIKEIKVLDKK+VRRAKLYY+R++MN LKK Sbjct: 228 VESLLPLYSPNIKEIKVLDKKRVRRAKLYYIRDKMNALKK 267 >gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] Length = 187 Score = 72.4 bits (176), Expect = 7e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE+L PLYSPNIKEIKVLDKKKVRRAKLYYLR++MN LK+ Sbjct: 147 VESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKR 186 >gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus vulgaris] Length = 231 Score = 72.4 bits (176), Expect = 7e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLK 119 +E+L PLYSPNIKEIKVLDKKKVRRAKLYYLR+RMN LK Sbjct: 192 IESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDRMNALK 230 >ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] gi|46390526|dbj|BAD16014.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|51536266|dbj|BAD38434.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|113535776|dbj|BAF08159.1| Os02g0205000 [Oryza sativa Japonica Group] gi|125538542|gb|EAY84937.1| hypothetical protein OsI_06303 [Oryza sativa Indica Group] gi|125581228|gb|EAZ22159.1| hypothetical protein OsJ_05821 [Oryza sativa Japonica Group] gi|215707036|dbj|BAG93496.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765566|dbj|BAG87263.1| unnamed protein product [Oryza sativa Japonica Group] Length = 222 Score = 72.4 bits (176), Expect = 7e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIKVLD+KKVRRAKLYYLR+RMN LKK Sbjct: 183 VESVFPLYSPNIKEIKVLDRKKVRRAKLYYLRDRMNALKK 222 >ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223550424|gb|EEF51911.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 190 Score = 72.4 bits (176), Expect = 7e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE+L PLYSPNIKEI+VLDKKKVRRAKLYYLR++MN LKK Sbjct: 150 VESLFPLYSPNIKEIRVLDKKKVRRAKLYYLRDKMNALKK 189 >ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Oryza brachyantha] Length = 222 Score = 72.0 bits (175), Expect = 9e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIK+LD+KKVRRAKLYYLR+RMN LKK Sbjct: 183 VESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 222 >gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilops tauschii] Length = 242 Score = 72.0 bits (175), Expect = 9e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIK+LD+KKVRRAKLYYLR+RMN LKK Sbjct: 203 VESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 242 >gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticum urartu] Length = 217 Score = 72.0 bits (175), Expect = 9e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIK+LD+KKVRRAKLYYLR+RMN LKK Sbjct: 178 VESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 217 >ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 212 Score = 72.0 bits (175), Expect = 9e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIK+LD+KKVRRAKLYYLR+RMN LKK Sbjct: 173 VESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 212 >dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326520856|dbj|BAJ92791.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 217 Score = 72.0 bits (175), Expect = 9e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIK+LD+KKVRRAKLYYLR+RMN LKK Sbjct: 178 VESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 217 >gb|EPS71409.1| hypothetical protein M569_03350, partial [Genlisea aurea] Length = 167 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 +E+L PLYSPNIKEIKVL+KKKVRRAKLYYLR++MN LKK Sbjct: 128 IESLFPLYSPNIKEIKVLEKKKVRRAKLYYLRDKMNALKK 167 >ref|XP_004160907.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 189 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 +E+L PLYSPNIKEIKVL+KKKVRRAKLYYLR++MN LKK Sbjct: 149 IESLFPLYSPNIKEIKVLEKKKVRRAKLYYLRDKMNALKK 188 >ref|XP_004139446.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 269 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 +E+L PLYSPNIKEIKVL+KKKVRRAKLYYLR++MN LKK Sbjct: 229 IESLFPLYSPNIKEIKVLEKKKVRRAKLYYLRDKMNALKK 268 >ref|XP_003563681.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 217 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKE+K+LD+KKVRRAKLYYLR+RMN LKK Sbjct: 178 VESVFPLYSPNIKEVKILDRKKVRRAKLYYLRDRMNALKK 217 >ref|XP_004975505.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Setaria italica] Length = 225 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 VENLLPLYSPNIKEIKVLDKKKVRRAKLYYLRERMNPLKK 122 VE++ PLYSPNIKEIKVLD+KKVRRAKLYYLR+RMN L+K Sbjct: 186 VESVFPLYSPNIKEIKVLDRKKVRRAKLYYLRDRMNALRK 225