BLASTX nr result
ID: Achyranthes23_contig00020773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00020773 (500 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004236701.1| PREDICTED: GLABRA2 expression modulator-like... 59 9e-07 ref|XP_006346745.1| PREDICTED: GLABRA2 expression modulator-like... 57 3e-06 >ref|XP_004236701.1| PREDICTED: GLABRA2 expression modulator-like [Solanum lycopersicum] Length = 300 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 500 VDNHEFWYMGFLNYENAVNILQEALQLRNILSV 402 VDNHEFW+MGFLNY AVN LQEALQ RN+ SV Sbjct: 268 VDNHEFWFMGFLNYSGAVNCLQEALQARNLHSV 300 >ref|XP_006346745.1| PREDICTED: GLABRA2 expression modulator-like [Solanum tuberosum] Length = 300 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 500 VDNHEFWYMGFLNYENAVNILQEALQLRNILSV 402 VD+HEFW+MGFLNY AVN LQEALQ RN+ SV Sbjct: 268 VDSHEFWFMGFLNYSGAVNCLQEALQARNLHSV 300