BLASTX nr result
ID: Achyranthes23_contig00020452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00020452 (742 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519173.1| conserved hypothetical protein [Ricinus comm... 60 8e-07 ref|XP_002273890.1| PREDICTED: protein DEHYDRATION-INDUCED 19 ho... 57 6e-06 >ref|XP_002519173.1| conserved hypothetical protein [Ricinus communis] gi|223541488|gb|EEF43037.1| conserved hypothetical protein [Ricinus communis] Length = 209 Score = 60.1 bits (144), Expect = 8e-07 Identities = 30/81 (37%), Positives = 53/81 (65%) Frame = -2 Query: 741 SDAAVDQLLTSFVCSYSTPSEAENKLLHSSADASAKEKVMGEDMLERGMKSCVISEEKQE 562 S+A D LL+SF+ + STP E + SS +A + + E+ ER ++ ++S++ QE Sbjct: 128 SNAEPDPLLSSFIFNPSTPDEPLSVQPLSSVEAVSVQGSTNEESRERNVQQSLLSDKDQE 187 Query: 561 EHAQRCKFMQSIVFSTMLDDD 499 E ++RC+F+Q ++ ST+LDD+ Sbjct: 188 EKSRRCRFVQGLLMSTILDDE 208 >ref|XP_002273890.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like [Vitis vinifera] Length = 221 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/81 (34%), Positives = 51/81 (62%) Frame = -2 Query: 741 SDAAVDQLLTSFVCSYSTPSEAENKLLHSSADASAKEKVMGEDMLERGMKSCVISEEKQE 562 S+ D LL+SF+ + E+ SS + + ++K + E+MLER M+ +S++ Q+ Sbjct: 140 SNTEPDPLLSSFIYNMPMVDVTESMQPSSSTEVNFEKKSLDENMLERNMQLSPLSDKDQK 199 Query: 561 EHAQRCKFMQSIVFSTMLDDD 499 E A++C+F+Q ++ ST LDD+ Sbjct: 200 EKAKQCEFVQGLLLSTFLDDN 220