BLASTX nr result
ID: Achyranthes23_contig00020224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00020224 (768 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451138.1| hypothetical protein CICLE_v10010038mg [Citr... 63 1e-07 ref|XP_006356160.1| PREDICTED: uncharacterized protein LOC102579... 59 2e-06 gb|EPS70840.1| hypothetical protein M569_03923, partial [Genlise... 57 7e-06 >ref|XP_006451138.1| hypothetical protein CICLE_v10010038mg [Citrus clementina] gi|557554364|gb|ESR64378.1| hypothetical protein CICLE_v10010038mg [Citrus clementina] Length = 91 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -2 Query: 446 GGNGGGRDIQCVCSPTSHPGSFRCRNHRAHYKWTSYVRTKLQS 318 GG+GGG QCVCSPT+HPGSFRCR+H A Y W + TK++S Sbjct: 45 GGSGGGLIKQCVCSPTTHPGSFRCRHHHAQYVWRGRI-TKVES 86 >ref|XP_006356160.1| PREDICTED: uncharacterized protein LOC102579994 [Solanum tuberosum] Length = 77 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/45 (55%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = -2 Query: 452 MSGGNGGGRDI----QCVCSPTSHPGSFRCRNHRAHYKWTSYVRT 330 +S GNG + QCVCSPT HPGSFRCR+H A YKW + + T Sbjct: 27 VSNGNGSSAEAGMMKQCVCSPTQHPGSFRCRHHHADYKWAAQLGT 71 >gb|EPS70840.1| hypothetical protein M569_03923, partial [Genlisea aurea] Length = 59 Score = 57.0 bits (136), Expect = 7e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -2 Query: 443 GNGGGRDIQCVCSPTSHPGSFRCRNHRAHYKW 348 G GGG C+CSPT HPGSFRCR+HR Y+W Sbjct: 26 GRGGGISRVCICSPTGHPGSFRCRHHRGDYRW 57