BLASTX nr result
ID: Achyranthes23_contig00019404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00019404 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O49071.1|IMPP_MESCR RecName: Full=Inositol monophosphatase; S... 59 7e-07 >sp|O49071.1|IMPP_MESCR RecName: Full=Inositol monophosphatase; Short=IMP; Short=IMPase; AltName: Full=Inositol-1(or 4)-monophosphatase gi|2708322|gb|AAB92418.1| inositol monophosphatase [Mesembryanthemum crystallinum] Length = 270 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 91 MASNVPLSDFLATAVDAAKKAGEVIRKGFY 2 MA+NVPLSDFLATAVDAAK+AGEVIRKGFY Sbjct: 1 MAANVPLSDFLATAVDAAKRAGEVIRKGFY 30