BLASTX nr result
ID: Achyranthes23_contig00019110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00019110 (545 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23205.1| unknown [Picea sitchensis] 58 2e-06 gb|AFW73670.1| hypothetical protein ZEAMMB73_468552 [Zea mays] 55 8e-06 gb|AFW73669.1| N-acetyltransferase [Zea mays] 55 8e-06 ref|XP_002452897.1| hypothetical protein SORBIDRAFT_04g034570 [S... 55 8e-06 ref|NP_001149697.1| LOC100283323 [Zea mays] gi|195629560|gb|ACG3... 55 8e-06 >gb|ABK23205.1| unknown [Picea sitchensis] Length = 272 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +1 Query: 397 YT*YFRYFVSSIAPSRVNPQLGEKKNYEILCRAFEEEARNKLE 525 YT RY +SSI+PSRV+P +G +K+YEILC+ F+ EA+ KLE Sbjct: 222 YTSKLRYIISSISPSRVDPLIGAEKSYEILCKTFDSEAKTKLE 264 >gb|AFW73670.1| hypothetical protein ZEAMMB73_468552 [Zea mays] Length = 218 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +1 Query: 412 RYFVSSIAPSRVNPQLGEKKNYEILCRAFEEEARNKLE 525 RY +SS +PSRV+PQ+G +K+YEILC+ F+ EA++KLE Sbjct: 177 RYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKSKLE 214 >gb|AFW73669.1| N-acetyltransferase [Zea mays] Length = 285 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +1 Query: 412 RYFVSSIAPSRVNPQLGEKKNYEILCRAFEEEARNKLE 525 RY +SS +PSRV+PQ+G +K+YEILC+ F+ EA++KLE Sbjct: 244 RYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKSKLE 281 >ref|XP_002452897.1| hypothetical protein SORBIDRAFT_04g034570 [Sorghum bicolor] gi|241932728|gb|EES05873.1| hypothetical protein SORBIDRAFT_04g034570 [Sorghum bicolor] Length = 174 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +1 Query: 412 RYFVSSIAPSRVNPQLGEKKNYEILCRAFEEEARNKLE 525 RY +SS +PSRV+PQ+G +K+YEILC+ F+ EA++KLE Sbjct: 133 RYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKSKLE 170 >ref|NP_001149697.1| LOC100283323 [Zea mays] gi|195629560|gb|ACG36421.1| N-acetyltransferase [Zea mays] gi|413939120|gb|AFW73671.1| N-acetyltransferase [Zea mays] Length = 256 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +1 Query: 412 RYFVSSIAPSRVNPQLGEKKNYEILCRAFEEEARNKLE 525 RY +SS +PSRV+PQ+G +K+YEILC+ F+ EA++KLE Sbjct: 215 RYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKSKLE 252