BLASTX nr result
ID: Achyranthes23_contig00018802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00018802 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169366.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 59 9e-07 ref|XP_004149493.1| PREDICTED: uncharacterized protein LOC101218... 59 9e-07 >ref|XP_004169366.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218879 [Cucumis sativus] Length = 697 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = +3 Query: 30 VIYPHENLPKPEAPPGLNGDVLEAFP--LNSSPENSFSVDVTNIGRYLLERKNSLSAAIS 203 V+ PH LPKPEAPPG++ + P + S + SVD+ +IG+++ ER NSLSAAI Sbjct: 121 VLEPHSQLPKPEAPPGISLSSADEPPHKRSQSLSENISVDMPSIGKFIRERSNSLSAAIF 180 Query: 204 RRLS 215 +R+S Sbjct: 181 KRIS 184 >ref|XP_004149493.1| PREDICTED: uncharacterized protein LOC101218879 [Cucumis sativus] Length = 666 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = +3 Query: 30 VIYPHENLPKPEAPPGLNGDVLEAFP--LNSSPENSFSVDVTNIGRYLLERKNSLSAAIS 203 V+ PH LPKPEAPPG++ + P + S + SVD+ +IG+++ ER NSLSAAI Sbjct: 90 VLEPHSQLPKPEAPPGISLSSADEPPHKRSQSLSENISVDMPSIGKFIRERSNSLSAAIF 149 Query: 204 RRLS 215 +R+S Sbjct: 150 KRIS 153