BLASTX nr result
ID: Achyranthes23_contig00018515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00018515 (500 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELR49853.1| hypothetical protein M91_20331, partial [Bos mutus] 65 1e-08 gb|ELR53142.1| hypothetical protein M91_08612, partial [Bos mutus] 64 3e-08 ref|XP_002589666.1| hypothetical protein BRAFLDRAFT_64030 [Branc... 62 1e-07 ref|XP_002598933.1| hypothetical protein BRAFLDRAFT_79864 [Branc... 62 1e-07 gb|EMC85008.1| Putative ubiquitin thioesterase L96, partial [Col... 60 3e-07 gb|EFN83834.1| hypothetical protein EAI_02648 [Harpegnathos salt... 60 3e-07 ref|XP_002586704.1| hypothetical protein BRAFLDRAFT_77465 [Branc... 60 4e-07 ref|XP_002805306.1| PREDICTED: hypothetical protein LOC100427671... 59 9e-07 gb|EMC89649.1| Putative ubiquitin thioesterase L96, partial [Col... 58 1e-06 gb|EFB21778.1| hypothetical protein PANDA_019388 [Ailuropoda mel... 58 1e-06 gb|EFB21665.1| hypothetical protein PANDA_015951 [Ailuropoda mel... 58 2e-06 ref|XP_002589890.1| hypothetical protein BRAFLDRAFT_81981 [Branc... 58 2e-06 ref|XP_001641822.1| predicted protein [Nematostella vectensis] g... 58 2e-06 gb|EDL82442.1| rCG63049 [Rattus norvegicus] 58 2e-06 gb|ELR51239.1| hypothetical protein M91_16214, partial [Bos mutus] 57 2e-06 ref|XP_003798497.1| PREDICTED: uncharacterized protein LOC100958... 57 3e-06 gb|EMC89475.1| Putative ubiquitin thioesterase L96, partial [Col... 57 3e-06 gb|EMC79721.1| hypothetical protein A306_12736, partial [Columba... 56 4e-06 gb|ELR54012.1| hypothetical protein M91_03060, partial [Bos mutus] 56 4e-06 ref|XP_001621760.1| hypothetical protein NEMVEDRAFT_v1g221604 [N... 56 6e-06 >gb|ELR49853.1| hypothetical protein M91_20331, partial [Bos mutus] Length = 282 Score = 64.7 bits (156), Expect = 1e-08 Identities = 49/151 (32%), Positives = 68/151 (45%), Gaps = 9/151 (5%) Frame = +3 Query: 69 NPIIYPKPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKIYS 242 +P I+P P S + +P IHP IHP P +HPS I+ Sbjct: 53 HPSIHPSIHPSPASSI-NPFIHPS-------------IHPSILPPLHPSMYPSIHPPIHP 98 Query: 243 FIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH----- 407 IH S H +S ++P IHP +L + I+P + SS H ++P +HP H Sbjct: 99 SIHPSIHPSLYSSIHPFIHPSLHLSIYPSIHPSLASSIHPSILRFIHPSLHPSIHPSFHT 158 Query: 408 --LQPF*VFPIIHPSYNL*PIS*IYPFIHPN 494 + PF PI P + P S IYP IHP+ Sbjct: 159 SSIHPFIHPPIHPPLHPSIPSSIIYPSIHPS 189 Score = 58.5 bits (140), Expect = 9e-07 Identities = 43/110 (39%), Positives = 54/110 (49%), Gaps = 5/110 (4%) Frame = +3 Query: 186 PKPVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL* 365 P P I+P +L I+ I S+H S ++P IHP + S I PFIH S H Sbjct: 20 PYPSIYPPIHLPIHPSIHPSILPSFHPSIPSSLHPSIHPSIHPSPASSINPFIHPSIHP- 78 Query: 366 SFL-----KVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 S L +YP IHP H P IHPS + S I+PFIHP+ H Sbjct: 79 SILPPLHPSMYPSIHPPIH-------PSIHPSIHPSLYSSIHPFIHPSLH 121 Score = 55.8 bits (133), Expect = 6e-06 Identities = 59/180 (32%), Positives = 77/180 (42%), Gaps = 36/180 (20%) Frame = +3 Query: 69 NPIIYPK--PIIQP--FSQVRDPVIHPKPFI*SFSQV*DSI-----------IHPK--PV 197 +P I+P P I P +S + P IHP + + + S+ IHP P Sbjct: 93 HPPIHPSIHPSIHPSLYSSIH-PFIHPSLHLSIYPSIHPSLASSIHPSILRFIHPSLHPS 151 Query: 198 IHPSYNL*PISKIYSFIHSSYH-----L*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL 362 IHPS++ S I+ FIH H S +YP IHP I FIH S H Sbjct: 152 IHPSFHT---SSIHPFIHPPIHPPLHPSIPSSIIYPSIHPSLASSIPPSILRFIHPSLHP 208 Query: 363 *SFLKVYPIIHPICH---LQPF*VFPI-----------IHPSYNL*PIS*IYPFIHPNYH 500 ++P IHP H + PF PI IHPS + S I+PFIHP+ H Sbjct: 209 ----SIHPSIHPSFHASSIHPFIHPPIHPPLHPSIPSSIHPSISA---SSIHPFIHPSIH 261 >gb|ELR53142.1| hypothetical protein M91_08612, partial [Bos mutus] Length = 282 Score = 63.5 bits (153), Expect = 3e-08 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 8/151 (5%) Frame = +3 Query: 72 PIIYPK------PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PI 227 P I+P P IQP P IHP SF IHP P +HPS + + Sbjct: 53 PTIHPSNHPSMLPTIQPSIH---PTIHP-----SFQPS----IHPPILPTVHPSIHPSVL 100 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 101 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 160 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 161 PS---IHPSIHPSIHPSIHPSIHPSIHPSIH 188 Score = 61.2 bits (147), Expect = 1e-07 Identities = 50/152 (32%), Positives = 65/152 (42%), Gaps = 8/152 (5%) Frame = +3 Query: 69 NPIIYPK---PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*P 224 +P I+P I P P IHP + SI IHP P IHPS + Sbjct: 72 HPTIHPSFQPSIHPPILPTVHPSIHPSVLPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSI 131 Query: 225 ISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPIC 404 I+ IH S H ++P IHP + I+P IH S H ++P IHP Sbjct: 132 HPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSI 191 Query: 405 HLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H + P IHPS + I+P IHP+ H Sbjct: 192 HPS---IHPSIHPSIHPSIHPSIHPSIHPSIH 220 Score = 59.7 bits (143), Expect = 4e-07 Identities = 51/151 (33%), Positives = 65/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 108 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 164 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 165 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 224 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS I+P IHP+ H Sbjct: 225 PS---IHPSIHPS--------IHPSIHPSIH 244 Score = 57.8 bits (138), Expect = 2e-06 Identities = 50/150 (33%), Positives = 65/150 (43%), Gaps = 7/150 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 132 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 188 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 189 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 248 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNY 497 V P IHP+ + I P IHP++ Sbjct: 249 PS---VLPTIHPTIHPSNRPSILPTIHPSF 275 >ref|XP_002589666.1| hypothetical protein BRAFLDRAFT_64030 [Branchiostoma floridae] gi|229274847|gb|EEN45677.1| hypothetical protein BRAFLDRAFT_64030 [Branchiostoma floridae] Length = 138 Score = 61.6 bits (148), Expect = 1e-07 Identities = 46/127 (36%), Positives = 58/127 (45%), Gaps = 2/127 (1%) Frame = +3 Query: 69 NPIIYPKPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKIYS 242 +P IYP IQP S P IHP IHP P IHPS + I Sbjct: 26 DPSIYPS--IQPSSH---PSIHPS-------------IHPSIHPSIHPSIHPSIHPSIQP 67 Query: 243 FIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF* 422 +H S H ++P IHP + + I+P IH S H ++P IHP H+ PF Sbjct: 68 SMHLSIHPSIHPSIHPSIHPSIHASIHASIHPSIHPSIHP----SIHPSIHPSIHIHPF- 122 Query: 423 VFPIIHP 443 + PIIHP Sbjct: 123 IHPIIHP 129 >ref|XP_002598933.1| hypothetical protein BRAFLDRAFT_79864 [Branchiostoma floridae] gi|229284208|gb|EEN54945.1| hypothetical protein BRAFLDRAFT_79864 [Branchiostoma floridae] Length = 279 Score = 61.6 bits (148), Expect = 1e-07 Identities = 55/156 (35%), Positives = 69/156 (44%), Gaps = 10/156 (6%) Frame = +3 Query: 63 VRNPIIYPKPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHP----------KPVIHPSY 212 +R I KP QP +Q P IHP PF + + IHP +P +HPS Sbjct: 101 LRQGTIKAKPR-QPSAQ---PSIHP-PF--HYPSILPLSIHPPIHPSIRPSVRPSVHPSI 153 Query: 213 NL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPII 392 + S IYSFIH S H ++P IHP I+P H S H +YP I Sbjct: 154 HPPIHSPIYSFIHPSIH----PSIHPFIHPSIRPSVRPSIHPSTHPSIHPSIHPSIYPSI 209 Query: 393 HPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 HP V P IHPS + I+P IHP+ H Sbjct: 210 HPS-------VRPSIHPSTHPSIHPSIHPSIHPSIH 238 Score = 56.6 bits (135), Expect = 3e-06 Identities = 48/148 (32%), Positives = 62/148 (41%), Gaps = 4/148 (2%) Frame = +3 Query: 69 NPIIYP--KPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKI 236 +P I+P +P ++P P IHP +S + SI HP P IHPS I Sbjct: 134 HPPIHPSIRPSVRPSVH---PSIHPPIHSPIYSFIHPSI-HPSIHPFIHPSIRPSVRPSI 189 Query: 237 YSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQP 416 + H S H +YP IHP +P IH S H ++P IHP H Sbjct: 190 HPSTHPSIHPSIHPSIYPSIHPSVRPSIHPSTHPSIHPSIHPSIHPSIHPSIHPSIHPST 249 Query: 417 F*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 P HPS I+ FIHP+ H Sbjct: 250 ----PSFHPS--------IHSFIHPSIH 265 >gb|EMC85008.1| Putative ubiquitin thioesterase L96, partial [Columba livia] Length = 128 Score = 60.1 bits (144), Expect = 3e-07 Identities = 42/111 (37%), Positives = 53/111 (47%), Gaps = 4/111 (3%) Frame = +3 Query: 180 IHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSS 353 IHP P IHPS + I+ IH S H ++P IHP + I+P IH S Sbjct: 14 IHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPS 73 Query: 354 YHL*SFLKVYPIIHPICH--LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H +YP IHP H ++P V P IHPS I+P IHP+ H Sbjct: 74 IHPSIHPSIYPSIHPSIHPSIRPS-VHPSIHPS--------IHPSIHPSIH 115 Score = 58.2 bits (139), Expect = 1e-06 Identities = 39/111 (35%), Positives = 54/111 (48%), Gaps = 4/111 (3%) Frame = +3 Query: 180 IHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSS 353 IHP P IHPS + I+ IH S H ++P IHP + I+P IH S Sbjct: 2 IHPSIHPSIHPSIH----PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPS 57 Query: 354 YHL*SFLKVYPIIHPICH--LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H ++P IHP H + P ++P IHPS + ++P IHP+ H Sbjct: 58 IHPSIHPSIHPSIHPSIHPSIHPS-IYPSIHPSIHPSIRPSVHPSIHPSIH 107 >gb|EFN83834.1| hypothetical protein EAI_02648 [Harpegnathos saltator] Length = 315 Score = 60.1 bits (144), Expect = 3e-07 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 39 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 95 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 96 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 155 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 156 PS---IHPSIHPSIHPSIHPSIHPSIHPSIH 183 Score = 60.1 bits (144), Expect = 3e-07 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 71 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 127 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 128 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 187 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 188 PS---IHPSIHPSIHPSIHPSIHPSIHPSIH 215 Score = 60.1 bits (144), Expect = 3e-07 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 103 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 159 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 160 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 219 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 220 PS---IHPSIHPSIHPSIHPSIHPSIHPSIH 247 Score = 60.1 bits (144), Expect = 3e-07 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 135 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 191 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 192 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 251 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 252 PS---IHPSIHPSIHPSIHPSIHPSIHPSIH 279 Score = 60.1 bits (144), Expect = 3e-07 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PI 227 +P I+P P I P P IHP + SI IHP P IHPS + Sbjct: 167 HPSIHPSIHPSIHPSIH---PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 223 Query: 228 SKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 I+ IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 224 PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 283 Query: 408 LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 284 PS---IHPSIHPSIHPSIHPSIHPSIHPSIH 311 Score = 59.7 bits (143), Expect = 4e-07 Identities = 49/148 (33%), Positives = 63/148 (42%), Gaps = 4/148 (2%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKI 236 +P I+P P I P P IHP IHP P IHPS + I Sbjct: 23 HPSIHPSIHPSIHPSIH---PSIHPS-------------IHPSIHPSIHPSIHPSIHPSI 66 Query: 237 YSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQP 416 + IH S H ++P IHP + I+P IH S H ++P IHP H Sbjct: 67 HPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPS- 125 Query: 417 F*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 126 --IHPSIHPSIHPSIHPSIHPSIHPSIH 151 Score = 56.2 bits (134), Expect = 4e-06 Identities = 39/109 (35%), Positives = 50/109 (45%), Gaps = 2/109 (1%) Frame = +3 Query: 180 IHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSS 353 IHP P IHPS I+ IH S H ++P IHP + I+P IH S Sbjct: 22 IHPSIHPSIHPS--------IHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPS 73 Query: 354 YHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H ++P IHP H + P IHPS + I+P IHP+ H Sbjct: 74 IHPSIHPSIHPSIHPSIHPS---IHPSIHPSIHPSIHPSIHPSIHPSIH 119 Score = 55.1 bits (131), Expect = 1e-05 Identities = 36/103 (34%), Positives = 48/103 (46%) Frame = +3 Query: 192 PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SF 371 P IHPS + I+ IH S H ++P IHP + I+P IH S H Sbjct: 20 PSIHPSIH----PSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIH 75 Query: 372 LKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 ++P IHP H + P IHPS + I+P IHP+ H Sbjct: 76 PSIHPSIHPSIHPS---IHPSIHPSIHPSIHPSIHPSIHPSIH 115 >ref|XP_002586704.1| hypothetical protein BRAFLDRAFT_77465 [Branchiostoma floridae] gi|229271827|gb|EEN42715.1| hypothetical protein BRAFLDRAFT_77465 [Branchiostoma floridae] Length = 263 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/99 (35%), Positives = 49/99 (49%) Frame = +3 Query: 204 PSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVY 383 PS P + I+SFIH S H ++P IHP + + I+P IH S H ++ Sbjct: 129 PSLTAGPATVIHSFIHPSVHPSIHPSIHPSIHPSIHPSIHASIHPSIHPSIHPSIHPSIH 188 Query: 384 PIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 P IHP H + P +HPS +L + I+P HP H Sbjct: 189 PSIHPSIHSS---IHPYMHPSIHLSIHTYIHPSTHPFIH 224 >ref|XP_002805306.1| PREDICTED: hypothetical protein LOC100427671 [Macaca mulatta] Length = 427 Score = 58.5 bits (140), Expect = 9e-07 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 3/110 (2%) Frame = +3 Query: 180 IHPK--PVIHPSYNL*PIS-KIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHS 350 IHP P IHPS +L I++ IH+S H S ++P IHP I+P IH Sbjct: 133 IHPHIHPSIHPSIHLSSTHPSIHTSIHASIHPPIHSCIHPSIHPS--------IHPCIHP 184 Query: 351 SYHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 S H +P IHP HL P + P IHP + I+P HP+ H Sbjct: 185 SIHTSIHASTHPSIHPCIHLHPC-IHPPIHPPIHPTIQPSIHPSTHPSMH 233 >gb|EMC89649.1| Putative ubiquitin thioesterase L96, partial [Columba livia] Length = 265 Score = 58.2 bits (139), Expect = 1e-06 Identities = 46/146 (31%), Positives = 66/146 (45%), Gaps = 2/146 (1%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPKPVIHPSYNL*PISKIYS 242 +P I+P P I P + P IHP ++ IHP +HPS +L + Sbjct: 91 HPSIHPSIPPSIHPSTH---PSIHPSTHPSTYPS-----IHPS--VHPSIHLSIHPSVCL 140 Query: 243 FIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF* 422 H S H + ++P IHP + I+P IH S H ++P IHP H Sbjct: 141 STHPSTHPSTHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPS--- 197 Query: 423 VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS++ S +P IHP+ H Sbjct: 198 IHPSIHPSFH----SPTHPPIHPSTH 219 Score = 57.4 bits (137), Expect = 2e-06 Identities = 49/149 (32%), Positives = 63/149 (42%), Gaps = 5/149 (3%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVR-DPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISK 233 +P YP P I P + +P IHP + S IHP P IHPS + Sbjct: 47 HPPTYPSVHPSIHPSTHPPINPTIHPPTHSSTHS-----FIHPSTHPPIHPSIHPSIPPS 101 Query: 234 IYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQ 413 I+ H S H + YP IHP ++P IH S H L +P HP H Sbjct: 102 IHPSTHPSIHPSTHPSTYPSIHP--------SVHPSIHLSIHPSVCLSTHPSTHPSTHPS 153 Query: 414 PF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P IHPS + I+P IHP+ H Sbjct: 154 ---IHPSIHPSIHPSIHPSIHPSIHPSIH 179 Score = 55.1 bits (131), Expect = 1e-05 Identities = 48/146 (32%), Positives = 61/146 (41%), Gaps = 4/146 (2%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKI 236 +P I+P P I P P IHP IHP P IHPS + I Sbjct: 151 HPSIHPSIHPSIHPSIH---PSIHPS-------------IHPSIHPSIHPSIHPSIHPSI 194 Query: 237 YSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQP 416 + IH S H S +P IHP + ++P IH+S H ++P IHP H Sbjct: 195 HPSIHPSIHPSFHSPTHPPIHPSTHTFMHPSMHPSIHASIHPSVCPPIHPSIHPSIH--- 251 Query: 417 F*VFPIIHPSYNL*PIS*IYPFIHPN 494 P IHPS I+P IHP+ Sbjct: 252 ----PSIHPS--------IHPSIHPS 265 >gb|EFB21778.1| hypothetical protein PANDA_019388 [Ailuropoda melanoleuca] Length = 198 Score = 58.2 bits (139), Expect = 1e-06 Identities = 46/151 (30%), Positives = 66/151 (43%), Gaps = 7/151 (4%) Frame = +3 Query: 69 NPIIYPKPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKIYS 242 +P IYP I P++ P IHP IHP P +HPS++L + I Sbjct: 21 HPSIYPS--IHPYTP---PSIHPS-------------IHPSFNPSVHPSFHLSFHTSILP 62 Query: 243 FIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF* 422 IH S H ++P IHP + I+P IH S H ++P IHP+ + Sbjct: 63 SIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPVTYPS--- 119 Query: 423 VFPIIHPSYNL-----*PIS*IYPFIHPNYH 500 P +H S + + I+P IHP+ H Sbjct: 120 TLPSVHTSIHTSTMYPSTLPSIHPSIHPSIH 150 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/107 (34%), Positives = 50/107 (46%) Frame = +3 Query: 180 IHPKPVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYH 359 IHP P IHPS + I+ + S H P +HP ++L + I P IH S H Sbjct: 11 IHP-PSIHPSIHPSIYPSIHPYTPPSIHPSIHPSFNPSVHPSFHLSFHTSILPSIHPSIH 69 Query: 360 L*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 ++P IHP H + P IHPS + I+P IHP+ H Sbjct: 70 PSIHPSIHPSIHPSIHPS---IHPSIHPSIHPSIHPSIHPSIHPSIH 113 >gb|EFB21665.1| hypothetical protein PANDA_015951 [Ailuropoda melanoleuca] Length = 194 Score = 57.8 bits (138), Expect = 2e-06 Identities = 54/159 (33%), Positives = 69/159 (43%), Gaps = 16/159 (10%) Frame = +3 Query: 72 PIIYPK---PIIQPFSQVRDPVIHPK---PFI*SFSQV*DSIIHPK---PV---IHPSY- 212 P IYP PI P P HP P S HP P+ IHPS Sbjct: 9 PSIYPSTHPPIHPPIHPSTHPSTHPSTHPPIHLSIHPPIHPSTHPSIHPPIHLSIHPSIY 68 Query: 213 -NL*PISK--IYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVY 383 N+ P ++ I+ IH HL S ++P +HP + + I+P IH S H + L + Sbjct: 69 PNIHPPTQPFIHRSIHPPIHLPIHSPIHPTVHPPVHPSTHPSIHPPIHPSTHPSTRLPKH 128 Query: 384 PIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 P HP H +P IHPS + PI IYP HP H Sbjct: 129 PFTHPSIHPP---TYPFIHPSIHP-PI--IYPSTHPPIH 161 >ref|XP_002589890.1| hypothetical protein BRAFLDRAFT_81981 [Branchiostoma floridae] gi|229275075|gb|EEN45901.1| hypothetical protein BRAFLDRAFT_81981 [Branchiostoma floridae] Length = 284 Score = 57.8 bits (138), Expect = 2e-06 Identities = 41/127 (32%), Positives = 55/127 (43%), Gaps = 2/127 (1%) Frame = +3 Query: 126 VIHPKPFI*SFSQV*DSIIHP--KPVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIH 299 +IHP F IHP +P IHPS + + IH S+H V+P IH Sbjct: 93 IIHPSIF---------PSIHPSVRPSIHPSVHPSVRPSVRPSIHPSFHPSIRPSVHPSIH 143 Query: 300 PGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYP 479 P + I+P H S H ++P IHP H + P IHPS ++P Sbjct: 144 PSIHPSIHPSIHPSTHPSIHPSIHPSIHPSIHPSIHPS---IHPSIHPSIRSSADPSVHP 200 Query: 480 FIHPNYH 500 IHP+ H Sbjct: 201 SIHPSIH 207 Score = 56.2 bits (134), Expect = 4e-06 Identities = 50/148 (33%), Positives = 61/148 (41%), Gaps = 4/148 (2%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKI 236 +P I+P P I P + P IHP + SI HP P IHPS + Sbjct: 143 HPSIHPSIHPSIHPSTH---PSIHPSIHPSIHPSIHPSI-HPSIHPSIHPSIRSSADPSV 198 Query: 237 YSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQP 416 + IH S HL V P I P + I+P IH S H ++P IHP H Sbjct: 199 HPSIHPSIHLSIHPSVRPSIRPSIHPSVHPSIHPSIHPSIHPSIHPSIHPSIHPSIH--- 255 Query: 417 F*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 P IHPS I P IHP+ H Sbjct: 256 ----PSIHPS--------IRPSIHPSIH 271 Score = 55.8 bits (133), Expect = 6e-06 Identities = 49/147 (33%), Positives = 65/147 (44%), Gaps = 4/147 (2%) Frame = +3 Query: 72 PIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKIY 239 P I+P P ++P VR P IHP SF +HP P IHPS I+ Sbjct: 108 PSIHPSVHPSVRP--SVR-PSIHP-----SFHPSIRPSVHPSIHPSIHPS--------IH 151 Query: 240 SFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF 419 IH S H ++P IHP + I+P IH S + V+P IHP HL Sbjct: 152 PSIHPSTHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIRSSADPSVHPSIHPSIHLS-- 209 Query: 420 *VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P + PS ++P IHP+ H Sbjct: 210 -IHPSVRPSIRPSIHPSVHPSIHPSIH 235 >ref|XP_001641822.1| predicted protein [Nematostella vectensis] gi|156228962|gb|EDO49759.1| predicted protein [Nematostella vectensis] Length = 304 Score = 57.8 bits (138), Expect = 2e-06 Identities = 42/119 (35%), Positives = 59/119 (49%), Gaps = 13/119 (10%) Frame = +3 Query: 180 IHPKPVIHPSYNL*PISKIYSF--IHSSYHL*SFSKVYPI--IHPGYNL*SFSKIYPF-- 341 ++P IHP Y L I +YS IH Y L + +YP+ IHP Y+L + +YP Sbjct: 4 LYPLLAIHPLYPLLAIHPLYSLLAIHPLYPLLAIHPLYPLLAIHPLYSLLAIHPLYPLLA 63 Query: 342 IHSSYHL*SFLKVYPII-----HPICHLQPF*VFPIIHPSYNL*PIS*IYPF--IHPNY 497 IH Y L + +YP++ +P+ + P IHP Y L I +YP IHP Y Sbjct: 64 IHPLYPLLAIHPLYPLLAIHPLYPLLAIHPLYPLLAIHPLYPLLAIHPLYPLLAIHPLY 122 Score = 57.0 bits (136), Expect = 3e-06 Identities = 47/146 (32%), Positives = 69/146 (47%), Gaps = 6/146 (4%) Frame = +3 Query: 78 IYPKPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPKPVIHPSYNL*PISKIYSF--IH 251 +YP +I P + VIHP ++P IHP Y L I +Y IH Sbjct: 167 LYPLLVIHPLYPLL--VIHP--------------LYPLLAIHPLYPLLVIHPLYPLLAIH 210 Query: 252 SSYHL*SFSKVYPI--IHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF*V 425 Y L + +YP+ IHP Y+L + +YP + + + L S L ++P+ +P+ + P Sbjct: 211 PLYSLLAIHPLYPLLAIHPLYSLLAIHPLYPLL-AIHPLYSLLAIHPL-YPLLAIHPLYS 268 Query: 426 FPIIHPSYNL*PIS*IYPF--IHPNY 497 IHP Y L I +YP IHP Y Sbjct: 269 LLAIHPLYPLLAIHPLYPLLAIHPLY 294 >gb|EDL82442.1| rCG63049 [Rattus norvegicus] Length = 169 Score = 57.8 bits (138), Expect = 2e-06 Identities = 46/131 (35%), Positives = 57/131 (43%), Gaps = 5/131 (3%) Frame = +3 Query: 123 PVIHPKPFI*SFSQV*DSI---IHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVY 287 P IHP + + SI IHP P IHPS + I+ IH S H ++ Sbjct: 33 PSIHPSTHPSTHQSIHPSIHPSIHPSIHPSIHPSIHPSIHPLIHPLIHPSIH----PSIH 88 Query: 288 PIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS 467 P IHP + I+P IHSS H +YP IHP H + IHPS Sbjct: 89 PPIHPSIHSFIHPSIHPSIHSSIHPFIHPSIYPSIHPSIHSS---IHTSIHPS------- 138 Query: 468 *IYPFIHPNYH 500 I+P IHP H Sbjct: 139 -IHPPIHPPIH 148 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/109 (35%), Positives = 53/109 (48%), Gaps = 2/109 (1%) Frame = +3 Query: 180 IHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSS 353 IHP P HPS + I+ IH S H + ++P IHP + I+P IH S Sbjct: 11 IHPSIHPSTHPSTHPSIHPSIHPSIHPSTHPSTHQSIHPSIHPSIHPSIHPSIHPSIHPS 70 Query: 354 YHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H ++P+IHP H + P IHPS + S I+P IHP+ H Sbjct: 71 IHP----LIHPLIHPSIHPS---IHPPIHPSIH----SFIHPSIHPSIH 108 Score = 56.2 bits (134), Expect = 4e-06 Identities = 42/115 (36%), Positives = 54/115 (46%), Gaps = 2/115 (1%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPKPVIHPSYNL*PISKIYS 242 +P I+P P I P P IHP S + +IHP IHPS + I+S Sbjct: 48 HPSIHPSIHPSIHPSIH---PSIHP-----SIHPLIHPLIHPS--IHPSIHPPIHPSIHS 97 Query: 243 FIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH 407 FIH S H S ++P IHP + I+P IHSS H ++P IHP H Sbjct: 98 FIHPSIHPSIHSSIHPFIHPSI----YPSIHPSIHSSIHTSIHPSIHPPIHPPIH 148 >gb|ELR51239.1| hypothetical protein M91_16214, partial [Bos mutus] Length = 306 Score = 57.4 bits (137), Expect = 2e-06 Identities = 53/155 (34%), Positives = 71/155 (45%), Gaps = 16/155 (10%) Frame = +3 Query: 78 IYPKPIIQPFSQVRD---PVIHPKPFI*SFSQV*DSI-----IHPK--PVIHPSYNL*PI 227 IYP P P + P IHP + S + SI IHP P IHPS + P Sbjct: 155 IYPSPSTHPSIPIHSSTHPPIHPSIYP---SSIHPSIHHHPPIHPSTHPPIHPSIHHHPP 211 Query: 228 --SKIYSFIHSSYHL*SFSKVYPI--IHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIH 395 IY+ +H S H + +YP IHP L + I+P IH S H ++P IH Sbjct: 212 IHPPIYASVHLSIHPSIYPSIYPYPSIHPSMLLSIYPFIHPSIHPSIH--HHPPIHPFIH 269 Query: 396 PICHLQPF*VFPIIHPSYNL*PI--S*IYPFIHPN 494 P H + P IHPS + P + I+P I+P+ Sbjct: 270 PSIHHSS--IHPSIHPSTHPSPSTHTPIHPSIYPS 302 >ref|XP_003798497.1| PREDICTED: uncharacterized protein LOC100958852 [Otolemur garnettii] Length = 462 Score = 57.0 bits (136), Expect = 3e-06 Identities = 55/169 (32%), Positives = 75/169 (44%), Gaps = 28/169 (16%) Frame = +3 Query: 78 IYPK--PIIQPFSQVRD-PVIHPKPFI*SFSQV*DSI---IHPK--------------PV 197 IYP P I P + + P IHP ++ + SI IHP P Sbjct: 166 IYPSIHPSIHPSTYLSVYPSIHPS----AYPSIHPSICLSIHPSIHLPIYPSIHLPIYPS 221 Query: 198 IHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYN--------L*SFSKIYPFIHSS 353 IHPS + I+ FI SS +L + +YP IH + L ++ YP IH S Sbjct: 222 IHPSIHPSAYLSIHPFICSSIYLPTHPFIYPSIHLSTHPPIHLSIQLSTYLLNYPSIHPS 281 Query: 354 YHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H ++L +YP IHP +L + IHPS L +YP IHP+ H Sbjct: 282 IHSSTYLPIYPSIHPSIYLS---IRLSIHPSTYL----SVYPSIHPSIH 323 >gb|EMC89475.1| Putative ubiquitin thioesterase L96, partial [Columba livia] Length = 129 Score = 56.6 bits (135), Expect = 3e-06 Identities = 40/109 (36%), Positives = 50/109 (45%), Gaps = 2/109 (1%) Frame = +3 Query: 180 IHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSS 353 IHP P IHPS + I+ IH S H ++P IHP + I+P IH S Sbjct: 10 IHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPSIHPS 69 Query: 354 YHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 H V+P IHP L P IHPS + I+P IHP+ H Sbjct: 70 IHPSIHPSVHPSIHPARALSWSQFSPSIHPSIHPSIHPSIHPSIHPSIH 118 >gb|EMC79721.1| hypothetical protein A306_12736, partial [Columba livia] Length = 129 Score = 56.2 bits (134), Expect = 4e-06 Identities = 44/117 (37%), Positives = 60/117 (51%), Gaps = 10/117 (8%) Frame = +3 Query: 180 IHPKPVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYH 359 IHP +HPS + P S + FIH S H S + P IHP L + I+P IH S H Sbjct: 2 IHPS--VHPS--ICPFS--HPFIHPSVHSSSDLSICPSIHPSILLSNHPVIHPSIHPSIH 55 Query: 360 L*SFLKVYP--------IIHPICH--LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 ++P IHP+ H +QPF V P IHPS + P + +P +HP++H Sbjct: 56 PSICPSIHPPTHPSILLSIHPVIHPSIQPF-VHPAIHPSIH--PST--HPSVHPSFH 107 >gb|ELR54012.1| hypothetical protein M91_03060, partial [Bos mutus] Length = 212 Score = 56.2 bits (134), Expect = 4e-06 Identities = 50/152 (32%), Positives = 65/152 (42%), Gaps = 8/152 (5%) Frame = +3 Query: 69 NPIIYPKPIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKIYS 242 +P YP PI P P IHP IHP P IHPS + I+ Sbjct: 80 HPSTYP-PIHPPTHLSIHPPIHPS-------------IHPSIHPPIHPSTHPPIYPSIHP 125 Query: 243 FIHSSYHL*SFSKVYP----IIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICH- 407 IH S H ++ ++P IHP +L + +P IH S H P IHP H Sbjct: 126 SIHPSIHPSTYPPIHPPTHLSIHPSVHLSTHPPTHPSIHPSIH--------PPIHPSTHP 177 Query: 408 -LQPF*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 + P + P IHPS +L +P IHP+ H Sbjct: 178 PIYPS-IHPSIHPSIHLSTHPPTHPSIHPSTH 208 Score = 55.8 bits (133), Expect = 6e-06 Identities = 50/148 (33%), Positives = 64/148 (43%), Gaps = 4/148 (2%) Frame = +3 Query: 69 NPIIYPK--PIIQPFSQVRDPVIHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKI 236 +P I+P P I P + + IHP + + SI HP P IHPS I Sbjct: 36 HPSIHPSTYPPIHPPTHLS---IHPSIHLSTHPPTHPSI-HPSTHPSIHPS----TYPPI 87 Query: 237 YSFIHSSYHL*SFSKVYPIIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQP 416 + H S H ++P IHP + + IYP IH S H YP IHP HL Sbjct: 88 HPPTHLSIHPPIHPSIHPSIHPPIHPSTHPPIYPSIHPSIHPSIHPSTYPPIHPPTHLS- 146 Query: 417 F*VFPIIHPSYNL*PIS*IYPFIHPNYH 500 IHPS +L +P IHP+ H Sbjct: 147 ------IHPSVHLSTHPPTHPSIHPSIH 168 Score = 55.5 bits (132), Expect = 7e-06 Identities = 44/130 (33%), Positives = 58/130 (44%), Gaps = 6/130 (4%) Frame = +3 Query: 129 IHPKPFI*SFSQV*DSIIHPK--PVIHPSYNL*PISKIYSFIHSSYHL*SFSKVYP---- 290 IHP ++ + IHP P IHP +L I+ IH S H ++ ++P Sbjct: 3 IHPSTYLPTHPS-----IHPSTYPPIHPPTHL----SIHPPIHPSIHPSTYPPIHPPTHL 53 Query: 291 IIHPGYNL*SFSKIYPFIHSSYHL*SFLKVYPIIHPICHLQPF*VFPIIHPSYNL*PIS* 470 IHP +L + +P IH S H YP IHP HL + P IHPS Sbjct: 54 SIHPSIHLSTHPPTHPSIHPSTHPSIHPSTYPPIHPPTHLS---IHPPIHPS-------- 102 Query: 471 IYPFIHPNYH 500 I+P IHP H Sbjct: 103 IHPSIHPPIH 112 >ref|XP_001621760.1| hypothetical protein NEMVEDRAFT_v1g221604 [Nematostella vectensis] gi|156208005|gb|EDO29660.1| predicted protein [Nematostella vectensis] Length = 508 Score = 55.8 bits (133), Expect = 6e-06 Identities = 50/137 (36%), Positives = 69/137 (50%), Gaps = 12/137 (8%) Frame = +2 Query: 2 LLPSIRPHHTPLAHHTVLLLSTKPHH-IPQAHHTTLLPSTRPRHTPQALH--IVLLPSIR 172 LL +I H T +H++ L T P H + Q +H+ L T PRHT + + IVLL ++ Sbjct: 226 LLVTISRHTTKQRNHSITPLVTIPRHTMKQRYHSITLLVTIPRHTMKQRNHSIVLLVTVP 285 Query: 173 LHHTPQARHTPQLQLIAHLQNIQFHTLQL--PLIVLLQSIPHHT--PRL*PIVLLQNIPF 340 H Q H LIA L I HT++ LI LL +IP HT R I L IP Sbjct: 286 RHTMKQRNH-----LIALLVTIPRHTMKQRNHLIALLVTIPRHTTKQRNHSIALPVTIPR 340 Query: 341 HTLQLP-----LIVLPQ 376 HT++ P L+ +P+ Sbjct: 341 HTMKQPNHSITLVTIPR 357