BLASTX nr result
ID: Achyranthes23_contig00018228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00018228 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004234946.1| PREDICTED: LRR receptor-like serine/threonin... 55 7e-06 >ref|XP_004234946.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Solanum lycopersicum] Length = 678 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +3 Query: 3 HGKFSMADASKLVRLALSCTHELPEERPDMEAVVQELSKRNSGS 134 HG+FS ++A+KL ++AL CTHE PEERP ME +V+E+ S S Sbjct: 635 HGRFSESEATKLAKIALLCTHECPEERPTMETIVREIGNLASPS 678