BLASTX nr result
ID: Achyranthes23_contig00017767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00017767 (529 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ01135.1| hypothetical protein PRUPE_ppa006327mg [Prunus pe... 56 4e-06 emb|CBI28698.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002278267.1| PREDICTED: pre-mRNA-splicing factor 18-like ... 56 6e-06 >gb|EMJ01135.1| hypothetical protein PRUPE_ppa006327mg [Prunus persica] Length = 417 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 3 PSKSIEFNSLANGSDLQALLMDEHNVGGGNQVTEE-MLQLPAP 128 PSK++EFNSLANGSDLQ+LL E GGNQ +EE +L +PAP Sbjct: 375 PSKAVEFNSLANGSDLQSLLASERASSGGNQASEEKLLIMPAP 417 >emb|CBI28698.3| unnamed protein product [Vitis vinifera] Length = 159 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 3 PSKSIEFNSLANGSDLQALLMDEHNVGGGNQVTEEMLQLPAPRGE 137 PSK++EFNSLANGSDLQ+LL +E GGNQ +EE L L AP E Sbjct: 115 PSKAVEFNSLANGSDLQSLLAEE-RFSGGNQASEERLHLMAPPKE 158 >ref|XP_002278267.1| PREDICTED: pre-mRNA-splicing factor 18-like [Vitis vinifera] Length = 412 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 3 PSKSIEFNSLANGSDLQALLMDEHNVGGGNQVTEEMLQLPAPRGE 137 PSK++EFNSLANGSDLQ+LL +E GGNQ +EE L L AP E Sbjct: 368 PSKAVEFNSLANGSDLQSLLAEE-RFSGGNQASEERLHLMAPPKE 411