BLASTX nr result
ID: Achyranthes23_contig00017629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00017629 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298836.1| PREDICTED: meiotic recombination protein SPO... 78 1e-12 gb|EXC34350.1| Meiotic recombination protein SPO11-2 [Morus nota... 77 2e-12 gb|EMJ09990.1| hypothetical protein PRUPE_ppa024198mg [Prunus pe... 75 1e-11 ref|XP_006368767.1| hypothetical protein POPTR_0001s09890g [Popu... 74 2e-11 ref|XP_006476493.1| PREDICTED: meiotic recombination protein SPO... 73 3e-11 ref|XP_006476492.1| PREDICTED: meiotic recombination protein SPO... 73 3e-11 ref|XP_006439466.1| hypothetical protein CICLE_v10024616mg [Citr... 73 3e-11 gb|EOY24856.1| Sporulation 11-2 [Theobroma cacao] 73 3e-11 gb|AAF24569.1|AC007764_11 F22C12.24 [Arabidopsis thaliana] 73 4e-11 ref|NP_176582.2| meiotic recombination protein SPO11-2 [Arabidop... 73 4e-11 ref|XP_006301476.1| hypothetical protein CARUB_v10021898mg [Caps... 72 6e-11 ref|XP_002886372.1| hypothetical protein ARALYDRAFT_474957 [Arab... 72 8e-11 ref|XP_004511556.1| PREDICTED: meiotic recombination protein SPO... 72 1e-10 ref|XP_004511555.1| PREDICTED: meiotic recombination protein SPO... 72 1e-10 ref|XP_006391688.1| hypothetical protein EUTSA_v10023831mg [Eutr... 71 1e-10 ref|XP_004246108.1| PREDICTED: meiotic recombination protein SPO... 71 2e-10 ref|XP_006344018.1| PREDICTED: meiotic recombination protein SPO... 70 2e-10 ref|XP_003611060.1| Meiotic recombination protein SPO11-2 [Medic... 70 2e-10 gb|EPS61073.1| hypothetical protein M569_13726 [Genlisea aurea] 70 4e-10 ref|XP_003538691.1| PREDICTED: meiotic recombination protein SPO... 70 4e-10 >ref|XP_004298836.1| PREDICTED: meiotic recombination protein SPO11-2-like [Fragaria vesca subsp. vesca] Length = 390 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EEL LM++SGQRAEIEALYCHGYD+LGK+ AKKIVQANYI Sbjct: 349 YREELRLMVESGQRAEIEALYCHGYDYLGKFIAKKIVQANYI 390 >gb|EXC34350.1| Meiotic recombination protein SPO11-2 [Morus notabilis] Length = 324 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 331 PDVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 P+ Y EEL+ M+QSGQRAEIEALYCHGYDFL K+ A KIVQANYI Sbjct: 280 PENYKEELTFMVQSGQRAEIEALYCHGYDFLRKFMANKIVQANYI 324 >gb|EMJ09990.1| hypothetical protein PRUPE_ppa024198mg [Prunus persica] Length = 382 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EEL+LM++SGQRAEIEALY HGYD+LGK+ AKKIVQANYI Sbjct: 341 YREELTLMVESGQRAEIEALYFHGYDYLGKFIAKKIVQANYI 382 >ref|XP_006368767.1| hypothetical protein POPTR_0001s09890g [Populus trichocarpa] gi|550346922|gb|ERP65336.1| hypothetical protein POPTR_0001s09890g [Populus trichocarpa] Length = 331 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 + EEL+LM+QSG+RAEIEALY HGYD+LGKY AKKIVQANYI Sbjct: 290 HREELALMVQSGKRAEIEALYFHGYDYLGKYIAKKIVQANYI 331 >ref|XP_006476493.1| PREDICTED: meiotic recombination protein SPO11-2-like isoform X2 [Citrus sinensis] Length = 382 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EELSLM+ +GQRAE+EALY HGYD+LGKY AKKIVQA+YI Sbjct: 341 YKEELSLMVHNGQRAEVEALYFHGYDYLGKYIAKKIVQADYI 382 >ref|XP_006476492.1| PREDICTED: meiotic recombination protein SPO11-2-like isoform X1 [Citrus sinensis] Length = 386 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EELSLM+ +GQRAE+EALY HGYD+LGKY AKKIVQA+YI Sbjct: 345 YKEELSLMVHNGQRAEVEALYFHGYDYLGKYIAKKIVQADYI 386 >ref|XP_006439466.1| hypothetical protein CICLE_v10024616mg [Citrus clementina] gi|557541728|gb|ESR52706.1| hypothetical protein CICLE_v10024616mg [Citrus clementina] Length = 382 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EELSLM+ +GQRAE+EALY HGYD+LGKY AKKIVQA+YI Sbjct: 341 YKEELSLMVHNGQRAEVEALYFHGYDYLGKYIAKKIVQADYI 382 >gb|EOY24856.1| Sporulation 11-2 [Theobroma cacao] Length = 382 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EEL+LM+QSG+RAEIEALY HGYD+LGKY AKKIVQA+YI Sbjct: 341 YREELALMMQSGKRAEIEALYFHGYDYLGKYIAKKIVQASYI 382 >gb|AAF24569.1|AC007764_11 F22C12.24 [Arabidopsis thaliana] Length = 299 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y+EELSLM+Q+G+RAEIEALYCHGY++LGKY A KIVQ YI Sbjct: 258 YIEELSLMVQTGKRAEIEALYCHGYNYLGKYIATKIVQGKYI 299 >ref|NP_176582.2| meiotic recombination protein SPO11-2 [Arabidopsis thaliana] gi|75335899|sp|Q9M4A1.1|SPO12_ARATH RecName: Full=Meiotic recombination protein SPO11-2; Short=AtSPO11-2 gi|7270977|emb|CAB81545.1| putative topoisomerase VIA [Arabidopsis thaliana] gi|91806019|gb|ABE65738.1| DNA topoisomerase VIA [Arabidopsis thaliana] gi|332196057|gb|AEE34178.1| meiotic recombination protein SPO11-2 [Arabidopsis thaliana] Length = 383 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y+EELSLM+Q+G+RAEIEALYCHGY++LGKY A KIVQ YI Sbjct: 342 YIEELSLMVQTGKRAEIEALYCHGYNYLGKYIATKIVQGKYI 383 >ref|XP_006301476.1| hypothetical protein CARUB_v10021898mg [Capsella rubella] gi|482570186|gb|EOA34374.1| hypothetical protein CARUB_v10021898mg [Capsella rubella] Length = 383 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 328 DVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 D Y +ELSLM+Q+G+RAEIEALYCHGYD+LGKY KIVQ YI Sbjct: 340 DNYRDELSLMVQTGKRAEIEALYCHGYDYLGKYIGTKIVQGRYI 383 >ref|XP_002886372.1| hypothetical protein ARALYDRAFT_474957 [Arabidopsis lyrata subsp. lyrata] gi|297332213|gb|EFH62631.1| hypothetical protein ARALYDRAFT_474957 [Arabidopsis lyrata subsp. lyrata] Length = 383 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 328 DVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 D Y +ELSLM+Q+G+RAEIEALYCHGY++LGKY A KIVQ YI Sbjct: 340 DNYRDELSLMVQTGKRAEIEALYCHGYNYLGKYIATKIVQGKYI 383 >ref|XP_004511556.1| PREDICTED: meiotic recombination protein SPO11-2-like isoform X2 [Cicer arietinum] Length = 383 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EE++LM+QSG+RAEIEALY HGYD+LGKY AKKIVQ++YI Sbjct: 342 YKEEVALMVQSGRRAEIEALYFHGYDYLGKYIAKKIVQSDYI 383 >ref|XP_004511555.1| PREDICTED: meiotic recombination protein SPO11-2-like isoform X1 [Cicer arietinum] Length = 397 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EE++LM+QSG+RAEIEALY HGYD+LGKY AKKIVQ++YI Sbjct: 356 YKEEVALMVQSGRRAEIEALYFHGYDYLGKYIAKKIVQSDYI 397 >ref|XP_006391688.1| hypothetical protein EUTSA_v10023831mg [Eutrema salsugineum] gi|557088194|gb|ESQ28974.1| hypothetical protein EUTSA_v10023831mg [Eutrema salsugineum] Length = 383 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y +ELS+MI++G+RAEIEALYCHGYD+LGKY A KIVQ YI Sbjct: 342 YRDELSMMIETGKRAEIEALYCHGYDYLGKYIATKIVQGKYI 383 >ref|XP_004246108.1| PREDICTED: meiotic recombination protein SPO11-2-like [Solanum lycopersicum] Length = 382 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 328 DVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 D Y EE++ MIQSG+RAEIEALYCHGYD+L K+ A KIVQANY+ Sbjct: 339 DSYKEEVAAMIQSGRRAEIEALYCHGYDYLVKFLATKIVQANYL 382 >ref|XP_006344018.1| PREDICTED: meiotic recombination protein SPO11-2-like [Solanum tuberosum] Length = 382 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -1 Query: 328 DVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 D Y EE++ M+QSG+RAEIEALYCHGYD+L K+ A KIVQANY+ Sbjct: 339 DSYKEEVAAMVQSGRRAEIEALYCHGYDYLVKFLATKIVQANYL 382 >ref|XP_003611060.1| Meiotic recombination protein SPO11-2 [Medicago truncatula] gi|355512395|gb|AES94018.1| Meiotic recombination protein SPO11-2 [Medicago truncatula] Length = 390 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = -1 Query: 322 YMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 Y EE++LM++SG+RAEIEALY HGYD+LGKY AKKIVQ++YI Sbjct: 349 YKEEVTLMVESGRRAEIEALYFHGYDYLGKYIAKKIVQSDYI 390 >gb|EPS61073.1| hypothetical protein M569_13726 [Genlisea aurea] Length = 379 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -1 Query: 331 PDVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 PD Y EEL M++SG RAEIEALY HGYDFLG+Y KKIVQ++YI Sbjct: 335 PDNYKEELGAMVESGCRAEIEALYWHGYDFLGRYIEKKIVQSDYI 379 >ref|XP_003538691.1| PREDICTED: meiotic recombination protein SPO11-2-like [Glycine max] Length = 382 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -1 Query: 328 DVYMEELSLMIQSGQRAEIEALYCHGYDFLGKYFAKKIVQANYI 197 D Y EE++LM+QSG+RAEIEALY +GYD+LGKY AKKIVQ++Y+ Sbjct: 339 DNYKEEVALMVQSGRRAEIEALYFNGYDYLGKYIAKKIVQSDYV 382